KEGG   Anolis carolinensis (green anole): 100554443
Entry
100554443         CDS       T01608                                 

Gene name
gadd45a
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04068  FoxO signaling pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100554443 (gadd45a)
   04068 FoxO signaling pathway
    100554443 (gadd45a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100554443 (gadd45a)
   04210 Apoptosis
    100554443 (gadd45a)
   04115 p53 signaling pathway
    100554443 (gadd45a)
   04218 Cellular senescence
    100554443 (gadd45a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acs03036]
    100554443 (gadd45a)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100554443 (gadd45a)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100554443 (gadd45a)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100554443
NCBI-ProteinID: XP_003225876
Ensembl: ENSACAG00000011832
UniProt: H9GI61
LinkDB
Position
Un
AA seq 160 aa
MTLEELAGEHQALGSMEKVGDALEEVLSKALTQRSITVGVYEAAKLLNVDPDNVVLCLLA
ADEEDNQDVALQIHFTLIQAFCCENDINILRVSNPSRLAELLLLGAGGGGGEPPADLHCV
LVTNPHASQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgactctggaagagctggcgggggagcaccaagcattgggaagcatggagaaagtagga
gacgccttggaagaagtcctaagcaaagccctgactcagagaagcatcacggtcggcgtg
tatgaggctgccaagctgctcaatgtggatccagataatgtggtgctttgtctgctggca
gcggatgaggaagacaatcaggatgttgctttgcaaatccatttcaccctgatccaagct
ttctgctgtgagaatgacatcaacatactccgagtgagcaaccccagtcgcctggcagag
ctcctgcttctgggggcaggcggaggagggggcgagccgcctgcggatttgcactgcgta
cttgtcaccaatccacatgcttctcagtggaaggatccagccctaagtcagctgatctgc
ttttgccgggaaagccgctatatggaccagtgggttcccgtgatcaaccttcctgaacgg
tga

KEGG   Anolis carolinensis (green anole): 100567812
Entry
100567812         CDS       T01608                                 

Gene name
gadd45g
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04068  FoxO signaling pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100567812 (gadd45g)
   04068 FoxO signaling pathway
    100567812 (gadd45g)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100567812 (gadd45g)
   04210 Apoptosis
    100567812 (gadd45g)
   04115 p53 signaling pathway
    100567812 (gadd45g)
   04218 Cellular senescence
    100567812 (gadd45g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acs03036]
    100567812 (gadd45g)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100567812 (gadd45g)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100567812 (gadd45g)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100567812
NCBI-ProteinID: XP_003227711
Ensembl: ENSACAG00000012182
UniProt: H9GIM1
LinkDB
Position
Un
AA seq 170 aa
MTLEEIHSQEAMPETSDSTASSATTSSRMQSAGKALQELLISSHRRGCLTAGVYESAKLM
NVDPDTVAFCVLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVNDIQKLAAIVGAASE
ESGEPRDLHCILVTNPSEDAWKDPSLDKLNLFCEESRNVNDWVPNITLPE
NT seq 513 nt   +upstreamnt  +downstreamnt
atgactctggaggaaatccacagccaggaagcgatgccggagactagtgacagcacggct
agcagtgccaccaccagcagcaggatgcaaagtgctggcaaagctcttcaggagctcctg
atctcctctcaccgccgcggttgcctcaccgccggcgtctacgaatctgccaagctgatg
aatgttgaccctgatactgtggccttctgtgtgcttgctgccgacgaggaggacgaggga
gacattgccctccagatccacttcaccctcatccaggctttctgttgcgagaacgacatc
gacattgtgagagtcaacgacatccagaagttggccgcgattgtgggtgccgccagcgag
gaatctggggaaccccgggacctgcattgcatcctcgtcacgaatcccagtgaggatgcc
tggaaggatccctccttggacaaactgaacttgttttgtgaggagagtcgaaatgtcaac
gactgggtgcccaatatcaccctgcctgagtga

DBGET integrated database retrieval system