KEGG   Anolis carolinensis (green anole): 100554618
Entry
100554618         CDS       T01608                                 

Gene name
pik3r3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04370  VEGF signaling pathway
acs04510  Focal adhesion
acs04620  Toll-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100554618 (pik3r3)
   04370 VEGF signaling pathway
    100554618 (pik3r3)
   04068 FoxO signaling pathway
    100554618 (pik3r3)
   04070 Phosphatidylinositol signaling system
    100554618 (pik3r3)
   04150 mTOR signaling pathway
    100554618 (pik3r3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100554618 (pik3r3)
  09143 Cell growth and death
   04210 Apoptosis
    100554618 (pik3r3)
   04218 Cellular senescence
    100554618 (pik3r3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100554618 (pik3r3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100554618 (pik3r3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100554618 (pik3r3)
   04625 C-type lectin receptor signaling pathway
    100554618 (pik3r3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100554618 (pik3r3)
   04914 Progesterone-mediated oocyte maturation
    100554618 (pik3r3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100554618 (pik3r3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100554618 (pik3r3)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100554618 (pik3r3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 DUF5638
Other DBs
NCBI-GeneID: 100554618
NCBI-ProteinID: XP_003220318
Ensembl: ENSACAG00000015856
LinkDB
Position
4
AA seq 725 aa
MASADGLQYRALYEYKKHREEDLALSPGDLLTVNRAGFVCMDYKEGEERNPKGWLNGFNE
RTKEQGDFPGTYVEYLGPVRIMTPTPKPRPLPPTPSKQLRGSPGQKELVDQINIPEQAPL
VVMRLVDALEKEGLDSEALYQAPSGSFWDPQLKQSLLTDMASVELDSFDGQTLAAMLWCY
LKELPCPVIHPAIYSELLFIVQETQTLEECGQQVKMVLESSCLPQWHRLLLQHLTRHFCK
VCQNNTKNHLTPRLLGEAFCGVLFKPSLSSMEMNLEHHVKIIEALIVAGGVSEAQAAPAL
PPKPSKPITPINTNGLKENCILSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKK
QGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKL
MYPISRYQQDQLVKEDNIDAVGKKLQEYHTQYQEKSKEYDRLYEEYTRTSQEIQMKRTAI
EAFNETIKIFEEQCHTQEQYSKEYIERFRREGNEKEIERIMMNYEKLKSRLGEIHDSKLR
LEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKNEN
IDDTYFTNEEDENLPHYDEKTWFVGDLNRIQAEDLLCGKPDGAFLIRESSKKGCYACSVV
ADGEVKHCVIYSTPRGYGFAEPYNLYSTLKELVLHYQHTSLVQHNDSLNVRLAYPVYAQM
SSLCR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggcctcggcggatgggctgcagtaccgagctctctatgaatataagaagcatcgggaa
gaagacctggctctctctccgggggacttgctgacagtcaacagagctgggtttgtgtgt
atggactacaaagaaggtgaagagaggaaccccaaaggctggctgaatggctttaatgaa
cgtaccaaggagcaaggagatttcccagggacctatgtagaatacctgggccccgtgagg
atcatgacccccaccccaaagccccggcccctgcctccaacaccttccaaacaactgagg
gggtcccctgggcagaaggagcttgttgatcagataaatatcccagaacaagcaccactg
gttgtaatgaggcttgtggacgctttagagaaagaaggcttagatagtgaagctctttac
caagccccttcaggatctttctgggatcctcaactaaaacagtctcttctgacagacatg
gcatcagttgaattggactcatttgatgggcagacgttagctgcaatgctttggtgctac
ctgaaggaactcccttgccctgtgatccatccagcaatatatagtgaattgctcttcata
gttcaagaaacacagactctggaagagtgtggtcaacaagtaaagatggtgctggaatct
tcctgcctgcctcagtggcacagacttcttttgcaacatctgactaggcatttctgtaaa
gtgtgccagaacaacaccaagaatcaccttacacctaggttacttggagaagccttttgt
ggagtgctttttaaaccatccttatcaagcatggagatgaatcttgagcaccatgtgaag
attattgaagctctcattgtagctggtggagtgtctgaggcccaggcagcaccagctctt
cctccaaaaccttccaaaccaataactccaataaatacaaatggactaaaagagaattgc
atcttatcactgcaggatgcggaatggtactggggagacatctcaagggaagaagtgaat
gacaaactacgagacatgccagatggaactttcctggttcgagatgcatcaacaaagaaa
caaggagactatacgctgacactaaggaaaggtggaaacaataaattaataaaaatttac
catcgggatggaaaatacggtttttctgatccactgacatttaattctgttgtggagcta
attaaccactatcaccatgagtctcttgcccaatataatcctaaacttgatgtgaaactg
atgtaccctatatccagataccagcaggatcagttggtaaaagaagataatattgatgct
gtaggcaaaaagcttcaggaataccacactcaatatcaagagaaaagcaaagagtatgac
agattatatgaagaatacaccagaacatcacaggaaattcaaatgaagagaacagcaata
gaagcgtttaatgaaacaattaaaatatttgaagaacaatgtcacacccaagagcaatat
agcaaggaatacattgaacgattccgaagagaagggaatgaaaaagaaattgaaaggatt
atgatgaattatgaaaaattaaaatcacgcctgggggagattcatgatagtaagctacgt
ttagaacaggatttgaagaagcaagccctggacaatcgggaaattgacaagaaaatgaac
agtatcaaacctgatcttattcagctgcgcaaaatcagagatcagtaccttgtttggctc
aatcataaaggagtgaggcagaaacgaataaatgactggctgggaatcaaaaatgaaaac
attgatgatacatactttacgaacgaagaggatgaaaatctgccacattatgatgaaaag
acctggtttgtaggtgatctcaatcgtattcaagcagaagatttgctttgtggaaaacct
gatggggcatttttaattcgggaaagtagcaagaaaggctgttatgcttgttctgtggta
gctgacggcgaagttaaacactgtgtgatttacagcactcctagaggttatgggtttgcg
gagccctacaacctatatagcacccttaaagaattagtcctccattaccagcatacctcc
cttgtccaacacaacgattccctcaatgtccggctggcgtatcctgtctacgcacagatg
tcctccctctgtagataa

KEGG   Anolis carolinensis (green anole): 100555182
Entry
100555182         CDS       T01608                                 

Gene name
pik3r2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04370  VEGF signaling pathway
acs04510  Focal adhesion
acs04620  Toll-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100555182 (pik3r2)
   04370 VEGF signaling pathway
    100555182 (pik3r2)
   04068 FoxO signaling pathway
    100555182 (pik3r2)
   04070 Phosphatidylinositol signaling system
    100555182 (pik3r2)
   04150 mTOR signaling pathway
    100555182 (pik3r2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100555182 (pik3r2)
  09143 Cell growth and death
   04210 Apoptosis
    100555182 (pik3r2)
   04218 Cellular senescence
    100555182 (pik3r2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100555182 (pik3r2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100555182 (pik3r2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100555182 (pik3r2)
   04625 C-type lectin receptor signaling pathway
    100555182 (pik3r2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100555182 (pik3r2)
   04914 Progesterone-mediated oocyte maturation
    100555182 (pik3r2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100555182 (pik3r2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100555182 (pik3r2)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100555182 (pik3r2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e Mod_r ATG11
Other DBs
NCBI-GeneID: 100555182
NCBI-ProteinID: XP_003230781
Ensembl: ENSACAG00000012750
LinkDB
Position
Un
AA seq 726 aa
MGSAEGFQYRARYPYRKEREEDIDLLPGDVLVVSKGALQALGGFRDGDEASPHRVGWIPG
VNERTRQKGDFPGTYVEYLGPVQIALPTQRPRMPRPLPAAPGPEAGPGMMLPELSEQFGP
PEVAPPLLCRMVEGIEKKGLENKKLYRTSGSELRQALRTDWAAVAAGDLEASDPLSLGDA
LKGFLQDLPTPVVPACAQAEILRVLQDAGPSPPDPCRPQLLSALEALPHPHLLTLRFLLR
HLATVATHAQSNGLCPRTLGEIFGPLLLRGAPSASAESVADFPAVFLQTLLQNKDPETDL
PAPALPPKPPKPKPVAGPLPNGGNGTPLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDA
SSKIQGEYTLTLRKGGNNKLIKIFHREGKYGFSEPLTFGSVVELINHYRHESLAQYNAKL
DTRLLYPISKFQQDQVVKEDSVEAVGEQLKAYHQQYQDKSREYDLLYEEYTRTSQELQMK
RTAIEAFNETIKIFEEQCQTQEKCSQDYMERFRREGNDKELQRILMNSEKLKSRIAEIHD
SKMKLEQDLKQQASENREIDKRMNSLKPDLLQLRKLRDQYLVWLTQKGTRQKKINEWLGI
KNETEDQYSMMEDEEELPHHDERTWYVGKIHRTQAEEMLAGKRDGTFLIRESSQRGCYAC
SVVVDGDTKHCVIYKTATGFGFAEPYNLYASLQELVLHYRHTSLVQHNDSLNVTLAHPIL
AQHPPR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgggcagcgccgaagggttccagtaccgggcccggtacccgtaccgcaaggagcgggag
gaggacatcgacctgctcccgggggacgtgctggtggtcagcaagggggccctgcaggcc
ctggggggcttccgggacggggacgaggcctccccacaccgcgtggggtggatcccgggg
gtcaacgagcgcacccggcagaagggggacttccccggcacctacgtggagtacctgggc
cccgtccagatcgccctcccgacacagcggccccggatgccccgacccctgcccgccgct
cccggcccggaggcgggtccaggaatgatgcttcccgagttgtcggagcagtttgggcca
cccgaagtggctccacctctgctgtgccggatggtggagggcatcgagaagaaagggctg
gagaacaagaagctctacaggacatcgggctccgaactcaggcaggcgctccgaactgac
tgggcggcggtggcggctggcgatctggaggcctcggaccctctttccctcggcgacgct
ctcaagggcttccttcaggacctcccgacccccgtggtgccggcctgcgcccaggcggaa
atcctgcgggtgctgcaagacgcgggcccctcgccgccggacccgtgccgcccgcagctc
ctctcggccctggaggccctgccccacccgcacctcctcaccctccggttcctcctgcgg
cacttggccacggtggccacccacgcccagagcaacgggctctgtccccggacgttgggg
gagatcttcgggcccctgctgctacggggggccccctccgccagtgcagagtcggtggcc
gacttccctgccgtcttcttgcaaacccttctgcagaacaaagacccagagaccgacctg
cccgctccagctctacctccgaagccccccaaaccgaagcctgtggcgggacccctcccc
aacggcggcaacgggacccccctccaggacgccgagtggtactggggcgacatttcccgg
gaggaagtgaacgagaagcttcgcgacaccccggacggcacgttcctggtacgagacgcc
tccagcaagatccaaggcgaatataccttgacgctcaggaaaggcggcaacaacaagctg
atcaagatcttccaccgggagggcaagtacggcttctcggagccgctgacctttggctcg
gtggtcgagctcatcaaccactaccggcacgagtcgctggcccagtacaacgccaagctg
gacacccgcctcctgtaccccatctccaagttccagcaggaccaagtagtgaaggaggac
agcgtggaggcagttggggagcagctgaaggcctaccaccagcagtaccaggacaagagc
cgcgagtatgacctgctctatgaggaatacacccgcacctctcaggaactacagatgaag
cggacggcgatcgaggccttcaacgagaccatcaagatcttcgaggaacagtgccagacg
caagagaagtgcagccaggactacatggagcgcttccggagggagggcaacgacaaggag
ctgcaacggatcctgatgaattcggaaaagctgaaatcccggatcgcggagatccacgac
agcaagatgaagctggagcaagacctgaagcaacaagcgagcgaaaaccgggagatcgac
aagcggatgaacagcctcaagccggacctgctccagctgcgcaaactccgggaccagtat
ctggtgtggttgacgcagaaggggactcggcagaagaagatcaacgaatggctcgggatc
aagaacgaaactgaggaccaatactccatgatggaggacgaggaggagctgccccaccac
gacgagcgcacgtggtacgtgggcaagatccaccgcacccaggcggaggagatgctggcc
ggcaagcgggacgggaccttcctgatccgggagagcagccagcgcgggtgctacgcgtgc
tccgtcgtggtggacggcgacaccaagcactgcgtgatctacaagacggccacgggcttt
ggcttcgcggagccctacaacctctacgcctcgctgcaggagctggtcctgcactaccgg
cacacctccctcgtccagcacaacgactccctcaacgtcaccctggcccaccccatcctg
gcccagcacccccccaggtga

KEGG   Anolis carolinensis (green anole): 100556883
Entry
100556883         CDS       T01608                                 

Gene name
pik3r1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04370  VEGF signaling pathway
acs04510  Focal adhesion
acs04620  Toll-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100556883 (pik3r1)
   04370 VEGF signaling pathway
    100556883 (pik3r1)
   04068 FoxO signaling pathway
    100556883 (pik3r1)
   04070 Phosphatidylinositol signaling system
    100556883 (pik3r1)
   04150 mTOR signaling pathway
    100556883 (pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100556883 (pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    100556883 (pik3r1)
   04218 Cellular senescence
    100556883 (pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100556883 (pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100556883 (pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100556883 (pik3r1)
   04625 C-type lectin receptor signaling pathway
    100556883 (pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100556883 (pik3r1)
   04914 Progesterone-mediated oocyte maturation
    100556883 (pik3r1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100556883 (pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100556883 (pik3r1)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100556883 (pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 AAA_13 DUF4201 SH3_2 Mod_r PI_PP_I V_ATPase_I Laminin_I
Other DBs
NCBI-GeneID: 100556883
NCBI-ProteinID: XP_003216391
Ensembl: ENSACAG00000016290
UniProt: G1KSH1
LinkDB
Position
2
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLRLGDILTVNKGTLVALGFSDGEEAKPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPVRPLPVAPSPSRVGTDSDQSGFALPDLSE
QFSSPDNAPPILIKLVEAIERKGLECSTLYRSQGSSSTNELRQITECDVSTVDFDSVDIQ
ILSDALKRYFLDLPNPVIPASVYNEMTSIAQEVQNSEEYAQVLKRLIRSPNIPQQYWLTL
QYLLKHFSRLCQSSNKNLLNARSLAEIFSLLLFRCPVASSDNTEHHIKILEVLITSEWNE
RQPAPALPPKPPKPNTVTNNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDSIEAVGKKLHEYNIQFQEKNREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRHRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSMVEDDEDLPHHDERTWNVGNINRSQAENLLRGKRDGTFLVRESSKPGCYACS
VVVDGEVKHCVINKTPTGYGFAEPYNLYNSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgcagaaggataccaataccgagctttatatgattacaaaaaagaacgagaagag
gacattgacttgcgcttgggagatattttaactgtgaataaaggtaccttagttgccctt
ggattcagtgatggggaagaagcaaaacctgaagaaattggttggttgaatggttataac
gaaactacaggagaaaggggggacttcccaggaacatatgtagaatatattggaaggaaa
aaaatctctcctccaactccaaagcctcgtcctgttcgaccccttcctgtggcaccaagt
ccttcaagagtaggaacagacagtgatcaatcaggttttgcacttccagatctttcagaa
cagttttcatcgcctgataatgctcctcccatccttatcaaattagtggaagcaattgaa
agaaaaggtctggaatgttcaaccttgtaccgatcacaaggatcaagcagtactaatgaa
ttaagacaaattactgagtgtgatgtttctacagtggattttgattccgttgatattcag
attttatcagatgctttgaagaggtactttcttgacttgccaaatcctgtcattccagca
tctgtttacaatgaaatgacttcgatagcacaagaagtgcagaactcagaggaatacgct
caagtactgaagaggctcatcagatcaccaaatatacctcaacagtattggctaacactc
caatatctgctcaaacatttttccagactttgccagagctctaacaaaaatcttctgaat
gcgagatctctagctgaaattttcagcctcctcctgttcaggtgcccagtagcaagctct
gacaatactgaacaccacattaaaatcctggaagtattaattacaagtgaatggaatgag
agacaacctgcaccagcactgcctcctaagcctccaaaacctaatactgtaacaaataac
ggtatgaataacaacatgtctctgcaagatgctgaatggtactggggagatatctcaagg
gaagaagtcaatgagaagctgcgtgacactgcagatggtacattcctggtacgagatgcc
tccaccaaaatgcatggggactacacacttacactaaggaaaggaggaaataataaatta
attaaaatatttcaccgagatgggaaatacggcttttcggatccattaacattcaattct
gtggttgagctaataaatcactacagaaatgagtctttggcgcaatataatccgaaactg
gatgttaaattgctttacccagtatccaagtatcaacaggatcaagtggtgaaagaagac
agcattgaggctgttggaaagaaattacatgaatataatatccagttccaagaaaagaac
agagagtatgacagactctatgaggactacacaagaacatctcaggaaattcaaatgaaa
agaactgctattgaagcatttaacgaaaccataaaaatatttgaggagcagtgccaaaca
caggaaagatacagcaaagaatatattgaaaaattcaaacgggaaggaaatgagaaagaa
atacaaagaattatgcataactatgaaaaattgaaatctcgaatcagtgaaatcgttgac
agtcggcatagactagaagaggatttaaagaagcaagcggctgaatatagagaaattgat
aaacgcatgaacagcattaaaccagaccttatacagctcagaaagactagagatcagtac
ttgatgtggctaactcaaaagggtgttcggcaaaagaaattgaatgaatggcttggaaat
gaaaatacggaagaccaatactctatggtggaagatgacgaagatttacctcatcatgac
gagcgaacatggaatgttggaaatatcaacagaagccaagctgaaaatttactacgtgga
aaacgggatgggactttccttgttcgggaaagcagtaaaccggggtgctatgcctgctct
gttgtggtggatggtgaagtgaagcactgtgttatcaacaaaacacctactggttatgga
ttcgcagagccatataacttgtacaactctctgaaagaactggtgctacattatcaacac
acttcgctagtgcagcacaatgactcactcaacgtcacactagcctatccagtatatgca
cagcagaggcgatga

KEGG   Anolis carolinensis (green anole): 100562345
Entry
100562345         CDS       T01608                                 

Gene name
pik3ca
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00562  Inositol phosphate metabolism
acs01100  Metabolic pathways
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04370  VEGF signaling pathway
acs04510  Focal adhesion
acs04620  Toll-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100562345 (pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100562345 (pik3ca)
   04370 VEGF signaling pathway
    100562345 (pik3ca)
   04068 FoxO signaling pathway
    100562345 (pik3ca)
   04070 Phosphatidylinositol signaling system
    100562345 (pik3ca)
   04150 mTOR signaling pathway
    100562345 (pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100562345 (pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    100562345 (pik3ca)
   04218 Cellular senescence
    100562345 (pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100562345 (pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100562345 (pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100562345 (pik3ca)
   04625 C-type lectin receptor signaling pathway
    100562345 (pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100562345 (pik3ca)
   04914 Progesterone-mediated oocyte maturation
    100562345 (pik3ca)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100562345 (pik3ca)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100562345 (pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100562345 (pik3ca)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100562345 (pik3ca)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100562345 (pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF5314 C2 Ribosomal_S15
Other DBs
NCBI-GeneID: 100562345
NCBI-ProteinID: XP_003218156
Ensembl: ENSACAG00000004872
UniProt: G1KDE7
LinkDB
Position
3
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLLNIKHELFKEARKYPLYQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDPEVQDFRRNILNVCKEAVDLRDVNAPHSRALYVCPPNIESSPELPKH
IYSKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDYVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYLLEKHPLSQYKYIRSCIMLGRMPNLMLMAKESLYTQLPLD
TFTMPSYSRRISTATPYMNGESSAKSLWAINSNLRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLQYEMQVLDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINMFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSPVKFPDMSVIEDHANWTISRELGFNYSHAGLSNRLARDNELRESDKEQLHAICTRDPL
SEITEQEKDFLWSHRHYCVNMPEILPKLLLSVKWNSRDEVAQMYCLIKDWPPIKPELAME
LLDCNYPDPMVRSFAIRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKNVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMKRPDFMDALQGFISPLNPAHQLGTLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEMYDPAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaaggccatcatctggggaactatggggcatccacttaatgccaccaagaatc
ctagtggaatgtcttctaccaaatggtatgatcgtgactttagaatgcctccgtgaggcc
actttgttaaatattaaacatgaactctttaaagaagctagaaaataccccctctatcaa
ctccttcaagatgagtcttcttacatttttgtaagtgttacacaagaagcagaaagagaa
gaattttttgatgaaacacggcgactatgtgacttacggctcttccagccctttctaaaa
gttatagagccagtaggcaacagggaagagaagattcttaatcgtgagatcggttttgct
attggcatgcctgtctgtgaatttgacctggtgaaagatccagaagttcaagacttcaga
agaaacattcttaatgtttgtaaagaagcagtagatttgcgggatgttaatgcaccccat
agtagagcattgtacgtctgtcccccgaacatagaatcttcgcctgagttgcccaagcac
atatacagtaaacttgataaagggcaaataatagtggtgatatgggttattgtctcccct
aacaatgacaagcagaagtacaccttaaaaataaatcacgactatgtaccagaacaagta
attgctgaagcaatcaggaaaaaaacacgaagcatgttgctgtcgtcagaacagctaaag
ctctgtgtgttggagtaccaggggaagtatattttaaaagtatgcggttgtgatgaatat
ttgctagaaaaacaccccctgagtcagtataagtatattcggagctgcatcatgcttggt
cgaatgcccaacttgatgctgatggctaaggaaagtctttatacccaactgccattggat
accttcacaatgccatcttattctcgacgtatctctacagctacaccatacatgaatgga
gaatcttctgcaaaatctctctgggctattaacagtaatcttagaatcaagattctctgt
gccacttatgtaaatgtaaatattcgggacattgacaagatctatgtccggactggaata
tatcatggtggagaaccattgtgtgataatgtgaatacgcagagagtaccttgctccaat
cccagatggaatgaatggctgcaatatgaaatgcaagttcttgatctcccacgtgctgct
cggctttgcctttctatctgctctgtcaaaggcagaaagggagcaaaggaggagcactgc
ccattggcgtgggggaatattaacatgtttgattacacagacacgcttgtttctggcaaa
atggctctgaatctgtggcctgtacctcatgggttggaagacctgctcaatcccattgga
gtcactggatcaaatccaaataaggaaactccctgtttggagttagaatttgattggttt
agcagtcctgtaaagtttcctgacatgtcagtaattgaagaccatgccaattggactatc
tctcgagagctaggatttaactacagtcatgctggactgagtaatagactagctagagac
aatgaattaagagagagcgataaagagcaactccatgcaatctgcactcgagaccctctg
tctgaaataactgaacaagaaaaggactttctttggagccacaggcactattgtgtcaat
atgccagaaattcttcctaagctgcttttgtctgttaaatggaactcaagagatgaagta
gcccagatgtactgcttgataaaagactggcctcccatcaagcctgaactagcaatggag
cttttggattgtaattacccagatccaatggtgcgatcatttgcaattcggtgtttggag
aaatacttgacagatgacaaactctcacagtatttgattcagttggtacaggttctgaaa
tatgagcaatacttggataatctgttggtgaggtttttactcaagaaggcactgaccaat
cagagaatagggcacttcttcttttggcatctaaagtctgaaatgcacaataaaaatgtg
agccagaggtttggtctgcttttggagtcctactgccgtgcatgtgggatgtacctgaaa
cacctgagcagacaagtggaagctatggaaaaactgattaacctcacagacatccttaaa
caagagaaaaaggatgaaacacaaaaggtacagatgaaattccttgtggaacaaatgaag
cggccagacttcatggatgcattgcaaggctttatatcccctctcaatcccgctcatcag
cttggaactcttaggctggaggagtgcagaattatgtcctctgctaagagaccattatgg
cttaattgggaaaacccagatattatgtctgagctgctgtttcagaacaatgagatcatc
tttaaaaatggggatgatctacgtcaggatatgctcacacttcaaataattcgaattatg
gaaaacatttggcaaaatcaaggccttgatcttaggatgttgccttatggttgtttatct
attggtgactgtgtgggactcattgaggtagtaagaaattcacatacaatcatgcagatc
caatgcaaaggtggtcttaaaggtgcactgcagttcaacagtcatacattacatcagtgg
ctcaaagataagaacaagggggaaatgtatgatcctgctattgatttgtttacacgctct
tgtgctggctattgtgtagctactttcatattgggaattggagatcgccacaatagcaat
attatggtgaaagatgatgggcagctgtttcatatcgattttggacacttcttggatcac
aaaaagaagaagtttggctacaaacgagagcgtgtgccatttgtcttaacacaagatttc
ttgatagtgattagtaaaggagcccaagaatgtactaaaacaagggaatttgagagattt
caagaaatgtgctacaaggcatatctagcaattcggcagcacgccaatcttttcataaac
ctcttctccatgatgcttggatcggggatgccagaactgcagtcttttgatgacattgca
tatattcgcaaaactcttgctttagacaaaactgaacaggaagcacttgagtatttcatg
aaacagatgaatgatgctcatcatggcggatggacaacaaaaatggactggatcttccac
acaatcaaacaacatgccttgaactga

KEGG   Anolis carolinensis (green anole): 100567254
Entry
100567254         CDS       T01608                                 

Gene name
pik3cb
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00562  Inositol phosphate metabolism
acs01100  Metabolic pathways
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04370  VEGF signaling pathway
acs04510  Focal adhesion
acs04620  Toll-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100567254 (pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100567254 (pik3cb)
   04370 VEGF signaling pathway
    100567254 (pik3cb)
   04068 FoxO signaling pathway
    100567254 (pik3cb)
   04070 Phosphatidylinositol signaling system
    100567254 (pik3cb)
   04150 mTOR signaling pathway
    100567254 (pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100567254 (pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    100567254 (pik3cb)
   04218 Cellular senescence
    100567254 (pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100567254 (pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100567254 (pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100567254 (pik3cb)
   04625 C-type lectin receptor signaling pathway
    100567254 (pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100567254 (pik3cb)
   04914 Progesterone-mediated oocyte maturation
    100567254 (pik3cb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100567254 (pik3cb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100567254 (pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100567254 (pik3cb)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100567254 (pik3cb)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100567254 (pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 RWD
Other DBs
NCBI-GeneID: 100567254
NCBI-ProteinID: XP_003218352
Ensembl: ENSACAG00000002884
UniProt: G1KBQ4
LinkDB
Position
3
AA seq 1067 aa
MMPPAMADTLDIWAVDSQIAADGSISVDCLLPTGIYISLDVPRDATICHIKQLLWKQAHS
YPLFHLLMEIDSYMFSCVNQTAVREELEDETRRLCDVRPFLPVLQLITRSCDPGEKLDSK
IGVLIGKGLHEFDALQDPEVKEFRIKMRRISEEKMQSLVRLSWMDWLKHTYPPELEPAVQ
ENLQDKLYGGNLVVAVHFDNCQDVFSFQVSPNIIPIKLNELAIRKRLTIHGREDEEVDPS
NYVLQVSGRLEYVFGDHPLIQFQYLHRCVMSRTLPQLTLIECSTIKKMCEQEMIAIEAAI
NRKPSNLPLPLPPKKSRVTQSVWDISQPFKVLLVNGSKLNTEETAKVHVRAGLFHGTELL
CKPIVSSEISGRNDHLWNEPLEFDINVCDLPRMARLCFVVYAVMDKMKNKKSAKSLNPSK
YQTIRKAGKVHYPVAWVNTMVFDFKGQFKTGDLVLHSWSSFPDELEEMLNPMGTVQTNPY
TENATSLQIKFQEYSKFPIYYPPFDKILEKAAEIARSSDSSGMAGRGGKKFYIELKEIME
RDPLSQLCENEMDLIWTLRYDCRENFPQSLPKLLLSVKWNKLEDVAQLQALLQIWSKLPP
REALELLDFNYPDQYVREYAVSCLRQMSDEELAQYLLQLVQVLKYEPFLDCALSRFLLEK
AMANRRIGQMLFWHLRSEVHIPAISVQFGVILEAFCRGSIAHMKVLSKQVEALNKMKTLN
NLIKLNAMKQSRAKGKEAMHTCLKQRVYKEALSDLQSPLNPSVLLSELYVEKCKYMDSKM
KPLWIVYNNKVFGGDLVVIMFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLA
TGDLSGLIEVISASETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEAFTL
SCAGYCVATYVLGIGDRHSDNIMVRKNGQLFHIDFGHILGNFKSKFGIKRERVPFILTYD
FIHVIQQGKTGNTEKFGRFRQCCEEAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQY
LKDSLALGKNDEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3204 nt   +upstreamnt  +downstreamnt
atgatgcctcctgccatggcagataccctggacatctgggcagtagattcacagatagca
gcggatggctcaatatctgtggattgcctgcttcccactggaatttacatcagtttagat
gtccctcgtgatgccactatttgtcatatcaaacagctgttatggaagcaagcacacagc
taccctctgtttcatcttcttatggagatcgactcctatatgttttcctgtgtgaaccaa
acagcggtacgtgaggaactagaggacgagacacggaggctttgtgatgttagaccattc
cttcctgttcttcaactaattacaagaagctgtgacccaggagaaaaattggattctaaa
ataggtgtccttataggaaaaggcctccatgagtttgatgccctacaagacccagaagtt
aaagaattccggataaagatgagacgaatcagtgaagagaagatgcaatcacttgtgagg
ttatcgtggatggactggttaaaacacacgtatccaccagaattggaaccagcagttcag
gaaaacctccaagataaactttatggtggcaatctagttgtggctgttcattttgataac
tgtcaagatgtgtttagttttcaggtttctcctaatattatccccatcaaattgaatgag
ctggcaattcgaaaacgtttaactatccatggaagggaagatgaagaagttgatccttct
aactacgtgcttcaagttagtggaagactggaatatgtctttggagaccacccattaatt
cagttccagtatcttcatcgttgtgtaatgagcagaactcttcctcagctgactctcatt
gagtgcagcaccattaaaaaaatgtgcgaacaggaaatgattgctatagaagctgccata
aaccgaaaaccttccaaccttccacttcctttgccccccaaaaagtcacgtgtgacacaa
agtgtatgggatattagccagcctttcaaggttctgctggtaaatggcagtaaactgaac
acagaagaaactgccaaagttcatgtcagggctggactcttccatggaactgagctcctt
tgtaagcccatcgtaagctcagaaatatctgggagaaatgaccatctttggaatgaaccc
ttggaattcgatattaacgtctgtgatttgccaagaatggctaggctgtgctttgtggtt
tatgctgtgatggataaaatgaaaaataaaaagtcagccaagtcactcaatccatccaaa
taccagaccattaggaaagcggggaaagtgcactatcctgtagcatgggtcaatactatg
gtctttgattttaaaggccaatttaaaactggagaccttgtactgcacagctggtcatca
tttcctgatgaacttgaagaaatgttgaacccaatgggaactgtacaaacaaatccatac
actgaaaatgcaacatctttgcagatcaaatttcaagagtattcaaaatttcctatttat
taccctccctttgataagatacttgaaaaggcagctgaaattgcgagaagcagtgatagc
tctggcatggcaggccgtggtggcaaaaagttctacattgagctaaaggagatcatggaa
agggaccctttgtctcaactctgtgaaaatgaaatggatctcatttggactttacggtat
gactgtcgtgaaaattttccacagtctttgccaaagttgttgctctccgtgaaatggaac
aaacttgaagatgtcgctcagcttcaagctcttcttcaaatatggtccaaactgcccccc
agagaagcattagagttgttggatttcaattatccagatcaatatgtaagagagtatgca
gtgagttgcttaaggcaaatgagtgacgaagagcttgctcaatatcttctacagcttgtg
caagtattgaaatatgaaccttttctcgactgtgccctatctaggttcctgctagaaaaa
gcaatggcaaatagaaggataggacagatgctgttttggcatttaagatcagaagtacat
attcctgcaatttcagtgcagtttggtgtgatacttgaagcattctgccgtggaagcatt
gctcacatgaaagtactttctaaacaggtagaagcactgaataagatgaaaacactgaat
aatttaataaaactgaatgccatgaagcaaagccgagctaaaggaaaagaagcaatgcac
acctgtttaaaacaaagagtgtacaaagaagccctttctgatctccaatcccctctgaat
ccttctgttttactttcagaactgtatgtggagaaatgtaaatacatggactctaaaatg
aagcctttgtggatagtgtacaataacaaagtatttggtggagatttggtggtgatcatg
tttaaaaatggagatgatctacggcaagacatgttgacgcttcagatgttacgcctgatg
gatttactttggaaggaggctggtctagatctacgaatgttgccttatggttgtttagca
acaggagatctttctggcttaattgaggtgatttctgcatctgagactattgcagacatt
caactaaacagcagtaatgttgctgctaccgctgcattcaataaagatgctcttttaaac
tggctcaaagaatacaactcgggagatgacttggatcgagccattgaagcatttacatta
tcttgtgctggctactgtgtagctacttacgtgctgggcataggagacagacatagtgac
aatatcatggtcaggaaaaatggtcagctctttcatatagattttgggcatattcttgga
aatttcaaatcaaaatttggaattaaaagggaacgagtgcctttcatcctcacctatgat
tttattcatgtcattcagcaagggaaaactggaaatactgaaaaatttggtcggtttcgc
caatgttgtgaagaagcatacttgattctgcgaagacatgggaacctctttatcactctc
tttgcactgatgttaactgctgggcttccagaactaacctctgttaaagacatccagtat
ctgaaggattcccttgccttaggaaagaatgatgaagaagcactaaagcaatttaagcag
aaatttgatgaagcactcagagaaagctggaccactaaagtgaactggatggcacacact
gttcggaaggactaccgatcctag

KEGG   Anolis carolinensis (green anole): 100567364
Entry
100567364         CDS       T01608                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00562  Inositol phosphate metabolism
acs01100  Metabolic pathways
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04370  VEGF signaling pathway
acs04510  Focal adhesion
acs04620  Toll-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100567364
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100567364
   04370 VEGF signaling pathway
    100567364
   04068 FoxO signaling pathway
    100567364
   04070 Phosphatidylinositol signaling system
    100567364
   04150 mTOR signaling pathway
    100567364
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100567364
  09143 Cell growth and death
   04210 Apoptosis
    100567364
   04218 Cellular senescence
    100567364
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100567364
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100567364
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100567364
   04625 C-type lectin receptor signaling pathway
    100567364
  09152 Endocrine system
   04910 Insulin signaling pathway
    100567364
   04914 Progesterone-mediated oocyte maturation
    100567364
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100567364
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100567364
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100567364
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100567364
Membrane trafficking [BR:acs04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100567364
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 PI3K_rbd PI3K_p85B Ribosomal_S15 C2
Other DBs
NCBI-GeneID: 100567364
NCBI-ProteinID: XP_003229426
Ensembl: ENSACAG00000011632
UniProt: H9GIG2
LinkDB
Position
Un
AA seq 1072 aa
MPPRPSSGELWGLHLMPPRIMVDCCLPNGMIVTLECLREATLLSIKHDLFKEARKYPLFH
LLQEESSYIFVGVTQEAEREEFFDESRRLCDLRLFQPILKVIEPVGNREEKILNREIGFA
IGMPICEFELVKDPEVQEFRRNILSVCREAVETRGSAGPQSQALYVYPPNVESSPELPKH
VYSKLDKGRIIVTIWVIVSPNNDKQKYTLKTPHDALPEQVIAEAIRKKTRSMHLSPEQLR
LCVQEYQGKYLLKVCGCDEYLLEKYPLSQYKYMRNCITIGRLPHLMLMSKESLYSQLPAN
VFVLPSYARRSATSAHVNGDVPSKSLWSINSLLRIKILCATYVNVNIRDIDKIYVRTGIF
HGGEPLCDNVNTQRVPCSNPRWNEWLSYDIYLPDLPRAARLCVSICSVKGRKGAKEEHCP
LAWGNVNLFDYKDTLVAGKMALNLWPVPHGLEDLLNPIGVGGSNPNKETPCLELEFTWFS
HTVKFADPTEIEEHANRAMSRELGLNYCMVGLSNRLARDSSLDESELEQLRNICNRDPLS
EITEQEKDFLWRHRHYCVNIPETLPKLLLSVKWNSRDEVAQMYCLVREWPLIKPELSMEL
LDCNFPDPVVREFALKCLVKGLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLTMKALTNQ
RIGHFYFWHLKSEMHSKPVSQRFGLMLEAFCRGCGMYLKHLNRQVEAMEKLINLTDILKQ
EKKDETQKMQMKFLVEQMRRPDYMEALQGFICPLNPVHQLGNLRLDECRIMSSAKRPLWL
NWENPDIMSELLFTNHEIIFKNGDDLRQDMLTLQIIRIMESMWQNQGLDLRMLPYGCLSI
GDCVGLIEVVKSSHTIMQIQCKGGLKGALQFNSNALHHWLKDKNKGEGYDAAIDLFTRSC
AGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFL
IVISKGVQECTKTKEFERFQEMCYKAYLTIRQHANLLINLFSMMLGSGMPELQSFDDVAY
LRKTLALDKSEQEALEYFTKQMNEAHHGGWTTKMDWIFHTIRHMPLSEASHD
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgcctccgcggccctcctccggggagctgtggggcctccacctcatgcccccgcgcatc
atggtggactgctgcctgcccaacgggatgatcgtcacgctggagtgcctgcgcgaggcc
accctcctcagcatcaagcacgacctcttcaaggaggcacggaagtacccgctcttccac
ctgctgcaggaggaatcttcctacatctttgtgggggtgacgcaggaggccgagcgggag
gagtttttcgacgagtcccggcggctttgcgacctgcgcctcttccagcccatcctgaag
gtcatcgagccggtcgggaaccgggaggagaagatcctcaaccgggagatcgggttcgcc
attgggatgcccatctgtgaatttgagctggtcaaggaccccgaggtgcaggagttccgg
cgcaacatcctctccgtttgccgcgaagccgtggagacgcggggctcggcggggccccag
agccaggccctctacgtctacccccccaacgtggagtccagccccgagttgcccaaacac
gtgtacagcaagctggacaaaggtcggatcatagtgaccatttgggttattgtgtctcca
aacaacgacaaacagaaatacaccctcaagaccccgcacgacgcgctgccggagcaggtg
atcgcggaggccatccggaagaagacccggagcatgcacctctcgccggagcagctgcgc
ctctgcgtgcaggagtaccaggggaagtacctgctcaaggtgtgcggctgcgacgagtat
ttgctcgagaaatacccgctcagccagtacaagtacatgcggaactgcatcaccatcggc
cgtctgccgcacctgatgctgatgagcaaggagagcctctacagccagctgccggccaac
gtcttcgtgctgccctcctacgcccggcgctcggccacctccgcccacgtcaacggggac
gtcccctccaagtccctctggtccatcaacagcctcctgcgcatcaagatcctctgcgcc
acatacgtcaacgtcaacatccgggacatcgacaagatctacgtccggacaggtatcttc
cacggcggagaacccctttgtgacaacgtcaacacccagcgggttccctgctccaaccct
cggtggaatgagtggctgtcgtacgacatttacctgccggaccttcctcgggccgccagg
ctctgtgtctccatttgttccgtcaaaggccgcaagggagccaaggaggagcattgtccc
ttggcctggggcaacgtcaacctctttgactacaaggacacgcttgtggccgggaagatg
gcgctgaacctgtggccggtgcctcacggactggaggacctgctgaaccccattggagtg
gggggctccaaccccaacaaggagaccccctgcctggagctggagttcacctggttcagt
cacacggtgaagtttgccgaccccacggagatcgaggagcacgccaaccgggccatgtcg
cgggaactgggcctcaactactgcatggtggggctgagcaaccgcttggcccgggacagc
tccctggacgaaagcgaactggagcagctgcgcaacatctgcaaccgggaccctctttcc
gagatcacggagcaagagaaggacttcctctggagacaccggcattactgcgtcaacatc
ccagagacgcttcccaagttgttgttgtccgtcaagtggaattcgcgggacgaggtggcc
cagatgtactgcctcgtgcgggagtggccgctcatcaagccggagctctccatggagctg
ctggactgcaacttcccggaccccgtggtgcgggagttcgccctcaagtgcctggtcaag
ggcctcaccgatgacaagctctcccagtatctcatccagctggtgcaggtcctcaagtac
gagcagtacctggacaaccccctggcccgcttcctgaccatgaaggccctcaccaaccag
cgcatcggacacttctacttctggcacctcaagtccgagatgcacagcaagccggtctcg
cagcgctttgggctgatgttggaggccttctgccgtggctgtgggatgtacttgaagcac
ctgaaccggcaggtggaggccatggagaagctcatcaacctgaccgacatcctcaagcag
gagaagaaggacgagacccagaagatgcagatgaagttcctcgtggagcagatgcggagg
ccggattacatggaggcccttcagggcttcatctgccccttgaaccccgttcaccagctg
ggaaacctccggctggacgagtgccggatcatgtcatctgccaagcgtccgttgtggctc
aactgggagaatcccgacatcatgtccgaactgctcttcacgaaccacgagatcatattt
aagaatggagatgaccttcggcaggacatgttgacgctgcagatcatccggatcatggag
agcatgtggcagaaccaagggctggatttacggatgctgccctacggctgcctgtccatc
ggggactgtgtggggctcatcgaggtggtcaagagctcccacaccatcatgcagatccag
tgcaagggcggcctcaagggagcgctgcagttcaacagcaacgccttgcaccactggctc
aaggacaagaacaagggagaggggtacgatgctgccatcgacctcttcacccgctcctgc
gccggatactgcgtggccaccttcatcctgggcatcggtgaccgccacaacagcaacatc
atggtcaaggatgatgggcagctcttccatatcgactttggccacttcctggaccacaag
aagaagaagtttggctacaagcgggagcgcgtccccttcgtcctgacccaggacttcctc
atcgtcatcagcaaaggcgtccaggagtgcaccaaaaccaaagagttcgagaggttccag
gagatgtgctacaaggcctacctgaccatccgccagcacgccaacctgctgatcaacctc
ttctccatgatgctgggctcggggatgccggagctgcagtccttcgacgacgtggcctac
ctgcgcaagaccctggccctggacaagtccgagcaggaggccctggagtacttcaccaag
cagatgaacgaggcccaccacggcggctggaccaccaagatggactggatcttccacacc
atccgccacatgcccctgagcgaggccagccacgactga

KEGG   Anolis carolinensis (green anole): 100568252
Entry
100568252         CDS       T01608                                 

Gene name
pik3cd
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00562  Inositol phosphate metabolism
acs01100  Metabolic pathways
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04370  VEGF signaling pathway
acs04510  Focal adhesion
acs04620  Toll-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100568252 (pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100568252 (pik3cd)
   04370 VEGF signaling pathway
    100568252 (pik3cd)
   04068 FoxO signaling pathway
    100568252 (pik3cd)
   04070 Phosphatidylinositol signaling system
    100568252 (pik3cd)
   04150 mTOR signaling pathway
    100568252 (pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100568252 (pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    100568252 (pik3cd)
   04218 Cellular senescence
    100568252 (pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100568252 (pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100568252 (pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100568252 (pik3cd)
   04625 C-type lectin receptor signaling pathway
    100568252 (pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100568252 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    100568252 (pik3cd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100568252 (pik3cd)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100568252 (pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100568252 (pik3cd)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100568252 (pik3cd)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100568252 (pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 100568252
NCBI-ProteinID: XP_008111838
Ensembl: ENSACAG00000013317
LinkDB
Position
h
AA seq 1047 aa
MLPGIYCPVEFWSKEANQSIQVDFLLPTGIYLTLSVSCNATLGTIKQLVWHHAQCEPFFH
MLSDPESYVFTCINQTAERQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLISSQISLL
IGKGLHEFDSLGDLEVDDFRVKMQHFCEERAARRQQLSWKAWMEYSFPVQLEPLANGLGG
RSLLQFPNKNIFVNVKFESGGESFTFQISPKEYPATLMSYAIKKQATVFRHQKINSPEDY
ALQINGKYEYLYGNHPLYQFQYIRDCLCRGLLPHLTMVHASSISALWEEQTNGISYPIKA
ASKAPPVPKKKPMSVSLWSLEQPYSIELVQGSKVNADERMKLVVQAGLYHGHEMLCKMVS
SSEVSVCSEPVWGQRLEFEINVCDLPRMARLCLALYAVVEKAKKARSTKKKSKKADCPIA
WVNVMLFDFRDQLKTGECCLPMWSSFPDEKGELLNPMGTVQTNPNTESAASLVIRFPTIS
SNPLYYPTFEQILEQGKNGQSSFSMVEDPEEKQQLKEILERRSHTDLYEHEKDLVWKMRH
QIRDQFPHALAKLLVVTKWNKHEDVAQMIYLLQSWPELPVLNALELLDFSFPDRYVGAFT
VNSLKKLTDADLFQYLLQLVQVLKYESYLDCELTKFLLGRALSNRKIGHFLFWHLRSEMH
VPSVALRFGLILEAYCRGSTFHMKALMKQTESLNKMKALNDLIKASSQKNAKPQTKEFMH
TCMRQETYLEALSNLQSPLNPSVILAKVSVELCTFMDSKMKPLWIVFNNEDAGGGHVGVI
FKNGDDLRQDMLTLQMIQLMDILWKKEGLDLRMTPYGCLSTGDKTGLIEVVMDSDTIANI
QLNKSNMAATAAFNKDALLNWLKSKNPGDALDRAIEEFTLSCAGYCVATYVLGIGDRHSD
NIMIRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFR
EYCERAYMILRCHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEARRHFQL
KFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3144 nt   +upstreamnt  +downstreamnt
atgctgcctgggatttattgtccggtcgaattttggtccaaagaagccaaccagagcatc
caagtggacttcctcttgcccaccggcatttacttgactctctccgtttcctgcaatgca
accctgggcaccatcaaacagctggtctggcaccatgcccaatgcgagcccttcttccac
atgctcagtgacccagagtcgtacgtcttcacctgcatcaaccagacggccgagcggcaa
gagctggaagacgagcagcggcgcctctgcgacatccagccattcttgccagtcctgcgg
ctcgtggcccgtgaaggcgaccgggtcaaaaagctgatcagttctcagatcagcctcctt
atcggcaaaggtttgcatgagtttgactctctgggagatctggaagtggacgacttccgt
gtcaaaatgcagcacttttgcgaggagagagcggcccggcggcagcagctaagctggaag
gcctggatggaatacagcttcccagtccaactggagcctttggccaatggactgggagga
aggtctctgctccagttccccaataagaacatttttgtcaacgtcaagtttgaaagtgga
ggggaaagttttaccttccagatctcgcccaaggagtaccctgcaacccttatgagctat
gccatcaagaagcaagcgactgttttccgtcaccaaaaaatcaacagccctgaagattat
gctttgcagattaatgggaaatatgaatacctctatggaaaccaccccttgtaccaattc
cagtacatccgcgactgcctctgccgcggcctccttccccacctcaccatggtacacgcc
tcctccatctcggctttgtgggaagagcagaccaatgggatttcctatcctataaaagca
gccagcaaagcacctccagtccctaagaaaaagccaatgtcggtgtctctgtggtccctt
gagcaaccttactctattgagttggtgcagggcagtaaagtgaatgcggacgagcggatg
aagttggtggtccaggcaggcctgtaccatggccatgagatgctctgcaagatggtctcc
agctcggaggtcagcgtctgctcggagccggtgtggggccagaggctggagtttgagatc
aacgtctgcgacttacctcgcatggcacggctctgcctggccctctatgcagttgtggag
aaagccaagaaggcaaggtccaccaaaaagaagtccaagaaagcggactgcccaattgcc
tgggtgaacgtcatgctgtttgatttccgagaccaactgaaaacgggagaatgctgccta
cccatgtggtcatcatttccagatgagaaaggagagctgttgaaccccatgggcacggtc
cagaccaaccccaacaccgagagcgcagcctccttggtcatccggttccccaccatttca
tccaacccactgtattatcccacctttgaacagatactggagcagggaaagaacgggcag
tcttccttctccatggtagaggatccagaggagaagcaacagctgaaggaaatcctggaa
cgcaggtctcacaccgacctctatgaacacgagaaggaccttgtgtggaaaatgaggcac
cagatccgagaccagttcccgcacgccttggcaaagctcttggttgtcaccaagtggaat
aaacacgaagatgttgctcagatgatctatttgctgcagtcctggccagagttgcctgtc
ctcaatgccctggagctgttggatttcagttttcctgatcgctatgtaggagccttcaca
gtcaactcactgaaaaaacttacagatgccgacttgttccaatacctcttgcagctggtc
caggtgctgaaatacgagtcctatttagactgcgaattaaccaagttcctcttgggccgg
gccttatccaaccgcaagattgggcacttcctcttctggcacctcaggtcagaaatgcat
gttccttctgtcgccttacgattcggcctgatcctggaggcctactgccgaggaagcacc
ttccacatgaaggctctgatgaaacagaccgaatccctcaacaagatgaaggcactcaat
gacctcatcaaagccagttcccagaagaatgccaagccccaaaccaaggagttcatgcac
acctgcatgcggcaggagacctacctggaagccctctccaacctccagtctcccttgaac
cccagcgtcattctggccaaagttagcgtggagctatgcactttcatggattcgaagatg
aagccgctgtggatcgtgtttaataacgaagacgctgggggaggccacgtgggtgtcatt
tttaaaaatggagacgaccttcgtcaggatatgttgaccctgcaaatgatccaactcatg
gacatcctgtggaagaaagagggcctagacttgcggatgaccccgtacggctgcctttca
acaggagacaagaccggattgatagaagtggtcatggactcggacaccattgccaacatc
cagctcaacaagagcaatatggccgccacagccgccttcaacaaggatgccttgttgaat
tggttgaaatccaagaaccctggtgatgccttggaccgggccattgaagagttcacgctt
tcctgtgctgggtattgtgtggccacctacgttttggggattggagaccgtcacagcgac
aacatcatgatccgagagaatggccagctgtttcacattgattttggccacttcttgggg
aacttcaagaccaagtttgggatcaatcgcgagcgggtccctttcatcttgacctatgac
ttcgttcacgtgatccaacaagggaaaacgaacaacagcgagaagtttgaacgattcaga
gagtactgtgaaagggcctacatgatcctccggtgccacggtctgctcttcctacacctg
tttgccctcatgaaagctgccgggttgcctgagctgagctgctccaaagacatccaatac
ctcaaggactccctggccttgggaaagaccgatgaagaagccaggagacacttccagctc
aagttcaatgaagctctccgggaaagctggaaaaccaaagtgaactggctggctcacaac
gtctccaaagacaaccggcaatag

DBGET integrated database retrieval system