KEGG   Anolis carolinensis (green anole): 100555243Help
Entry
100555243         CDS       T01608                                 

Gene name
gstz1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00350  Tyrosine metabolism
acs01100  Metabolic pathways
Module
acs_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100555243 (gstz1)
Enzymes [BR:acs01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100555243 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 100555243
NCBI-ProteinID: XP_003214419
Ensembl: ENSACAG00000017198
UniProt: G1KTM3
LinkDB All DBs
Position
1
AA seq 217 aa AA seqDB search
MCAAVAKPLLYTYFRSSCTWRVRIALALKGIAYDPAPVNLVKDGGQQLSPEFQAVNPMKQ
VPALKIDGVTLSQSLAIIEYLEETRPNPRILPQDPKKRAQVRMISEHIASGIQPLQNLSV
LQQMGDKKVDWAQRSISSGFEALERILQETAGRYCVGDEVTMADLCLVPQVYNADRYQVD
LTPYPTIRRINKALLELEAFQTSHPSRQPDTPADLKA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgccgcggtagccaagccactcctctatacttattttagaagctcctgcacctgg
agagtgcgaattgcactggctctgaagggcattgcctatgatccagcccctgtgaatctt
gtgaaggatggagggcagcagctttctccagaattccaagcagtgaatccaatgaagcaa
gtccctgctctcaaaattgatggcgtcactctatcacagtcgctggccataatagagtat
ctggaggagacaagaccaaatcctaggattctccctcaggatcctaagaagagagctcag
gtccggatgatctcagagcatattgcatctggaattcaacccttgcagaacttaagtgtc
cttcagcaaatgggagacaagaaggtagactgggcacaacgcagcatttctagtggcttt
gaagctttggaacggattctgcaagaaacagctggacgctactgtgttggggatgaggtg
accatggctgatttgtgcttggtcccccaagtatacaatgctgacagatatcaagtggat
cttacgccctaccccacaataagacgaatcaacaaagctcttctggagttagaagcattc
cagacaagccacccatctcggcagccagatacccctgcagacctaaaagcctga

DBGET integrated database retrieval system