KEGG   Anolis carolinensis (green anole): 100555337
Entry
100555337         CDS       T01608                                 

Gene name
cdkn1a
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100555337 (cdkn1a)
   04068 FoxO signaling pathway
    100555337 (cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100555337 (cdkn1a)
   04115 p53 signaling pathway
    100555337 (cdkn1a)
   04218 Cellular senescence
    100555337 (cdkn1a)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100555337
NCBI-ProteinID: XP_003220403
Ensembl: ENSACAG00000016653
UniProt: G1KSV7
LinkDB
Position
4
AA seq 149 aa
MPLSESNIQRPSCSRKICRNLFGAVDHEQLQKDFQTLLRAQLEEAQQKWNFDFETETPLE
GNYKWEKVSHLHTLPSQDLKSHTKENTCTGEKSMNSPVALKKPAKTDSLAQIGFEACTAG
SSRTSKRKQTSIKDFYSSKRRTIPYKSSP
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcctctgtctgagagtaatatccaacgaccttcctgcagcaggaaaatctgtagaaac
ctctttggagctgtggaccatgaacagctacagaaagacttccagaccttgctgagggcc
cagctggaggaggcacagcaaaagtggaactttgactttgaaacagaaacgccacttgaa
ggcaactacaaatgggagaaggtctcccacctacacacacttccatctcaagacctgaag
agccacacaaaggagaacacatgcactggggagaagagcatgaactctcctgtggccctc
aagaaacctgcaaagaccgacagtctggcacagattggctttgaggcttgcactgctggc
tcttcaagaacttcgaagcgaaagcagacgtccataaaagacttctacagctctaagagg
agaacgatcccatataagtcaagcccatga

DBGET integrated database retrieval system