KEGG   Anolis carolinensis (green anole): 100555490
Entry
100555490         CDS       T01608                                 

Gene name
gorab
Definition
(RefSeq) golgin, RAB6 interacting
  KO
K19748  RAB6-interacting golgin
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100555490 (gorab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100555490 (gorab)
Membrane trafficking [BR:acs04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    100555490 (gorab)
SSDB
Motif
Pfam: Transcrip_act Cdh1_DBD_1
Other DBs
NCBI-GeneID: 100555490
NCBI-ProteinID: XP_008116031
LinkDB
Position
Un
AA seq 212 aa
MAQGWGGFSERELRRVQGRCKDQSEPLPEQKHQSFVKQNYQHLKGKKSVQQICEKTELPD
GAALSPQKQRLSGPKRNCPSPQASLLPPQSLTTGEPQDTRNQEMRQVSNCDSHAEPSHTL
GKKRMELQEKSRWEILQREQKLMEEKNKRKKALLAKAIAERSKRTQAETMKLNKIQKQLQ
ALDVMVSADIGILRNRIDQASLDYSCARKRYE
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcgcagggctggggcgggttctccgagcgggagctccggcgggtccagggccgttgc
aaagatcaatctgagcctctgcctgagcagaagcatcaatcttttgtgaagcagaattac
cagcatttgaagggcaaaaagtctgtccagcagatatgtgaaaaaacagaactgccagat
ggagcagccttgtcacctcagaagcagaggctttctggacctaaacggaactgcccgtct
ccacaggcatctctgttaccaccccagtctctgacaacaggagaaccacaggataccaga
aaccaagaaatgagacaagtgtctaattgtgattcccatgcagagcctagtcacacattg
ggaaagaagaggatggaattgcaggagaagtctcggtgggaaattcttcagcgggaacag
aagcttatggaagaaaagaacaaacgcaagaaagctcttttggctaaagcaattgctgaa
agatccaaaagaactcaggctgaaacaatgaagttaaataagatccaaaaacagctccaa
gctctagatgttatggtatctgccgatattgggatactgagaaataggattgaccaggca
agtttggattattcgtgtgctcggaagcgatatgaataa

DBGET integrated database retrieval system