KEGG   Anolis carolinensis (green anole): 100555513
Entry
100555513         CDS       T01608                                 

Gene name
ccng1
Definition
(RefSeq) cyclin G1
  KO
K10145  cyclin G1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100555513 (ccng1)
SSDB
Motif
Pfam: Cyclin_N RD3
Other DBs
NCBI-GeneID: 100555513
NCBI-ProteinID: XP_003215166
Ensembl: ENSACAG00000014615
LinkDB
Position
1
AA seq 295 aa
MIETFATSEAQELLHQLNVLLEQELKCQPKFSGLRIIESAHDNGLRMTARLRDFEVKDLL
SLIQFFGFGTETFSLAVNFLDRFLSKMKVQPKHLGCVGLSCFYLAVKVTQEERNVPLATD
LIRISQYQFTISDLMRMEAILLEKLCRKVKATTAFHFLQLFHSILHGSLSCERKSYLNLE
RLEAQLKACHCRLILSKAKPSVLALSIMALNVEEEKLLELVEMIESLRTYSKLSGRELSL
WKELVSKCLSEYSSSKCSKPNVQKLKWIVSGRTARQLKHSYYRIAHLPTIPESGL
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatcgaaacatttgccacaagtgaagctcaagaactgctgcatcagctgaatgtgtta
ctggaacaggagttaaaatgtcagccaaagttttctggcctaagaataattgaatctgct
catgataacgggcttcgaatgactgcgagattgagagactttgaagtgaaggacctcctt
agtttaattcagttctttggctttggtacagagacattttctcttgctgtgaatttcttg
gacaggtttttatcaaaaatgaaggtgcagccgaaacacttgggatgtgttgggctaagt
tgcttctacctggctgtgaaagtgacccaagaagagagaaatgttccactagccacagac
ttaatcagaatcagccagtatcaattcaccatttcagacctcatgaggatggaggcgatt
cttctggagaagctttgtaggaaagtgaaggcaacaaccgccttccattttctgcaactt
ttccattcaatcctacatggtagcctaagttgtgaaaggaaaagttaccttaatttagag
agactggaagcccagctgaaggcatgccactgcaggcttattctttctaaagcaaagccg
tcggtgttggctctttcaataatggccctcaacgttgaagaagaaaagcttctggagctg
gtggaaatgatagaaagccttcgaacatattccaagctaagtggcagagagctctcactt
tggaaggaacttgtctcaaaatgcctctcagagtattcctcaagcaagtgctcaaaacca
aatgttcagaagttgaagtggatagtgtctggtcgcacagcaaggcagctaaagcacagc
tactatagaatagcccatcttcccactatccccgaaagtggtctctaa

KEGG   Anolis carolinensis (green anole): 100556642
Entry
100556642         CDS       T01608                                 

Gene name
ccng2
Definition
(RefSeq) cyclin G2
  KO
K10146  cyclin G2
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100556642 (ccng2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100556642 (ccng2)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 100556642
NCBI-ProteinID: XP_008110348
Ensembl: ENSACAG00000012149
LinkDB
Position
5
AA seq 369 aa
MRLQHPIYAHSQTALRAAFLHTYLTMKDTGVEVQMSSWLFKQLKLHLEQEWKYQPREKGL
SLIECTAENENTICPRLRNAKVEDLWSLTNFFGFATETFVLAVNILDRFLALMKVKPKHL
SCIGVCCFQLAAQVVEEQCNIPSLHDVIRISQCKCTASDLKRMEKIISEKLHFDFKATTA
LTFLHLYHTIILCHTSERKELLNLDKLEAQLKACNCRLVFSKAKPSVLALCLLSLEVQTL
KSIELFEIVLCIQKYSKISDSDLLYWRELVSKCLADYSSPACCKPDHKKLVWIVSRRTAQ
NLQNSYYSVPELPTIPEVGCFDGSESEDSCEDMSCGEESLSSSPPSDLEGSFFFDLKPKS
KWPALSFDS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaggctccagcatccaatttatgctcattcacagacagccttgagggctgctttcttg
catacctacttgactatgaaggatactggagttgaagtccagatgagtagctggctcttc
aagcagctgaaactccacttggaacaggaatggaagtaccaaccaagggaaaaggggcta
agcttgattgagtgtactgctgagaatgaaaacaccatatgtcccagactgcgaaatgca
aaagtggaagatctctggagtctgacaaacttctttggatttgccactgaaacatttgtc
ctggctgtcaacattctagatagatttttggcacttatgaaggtgaaaccgaagcatttg
tcctgcattggcgtctgttgttttcaattggctgctcaagtggttgaagagcaatgcaac
attccctccctccacgatgtcatccgaattagccagtgcaagtgcacagcatctgatctg
aagcggatggagaaaataatctcagaaaaactgcactttgacttcaaagctactactgcc
ttaacctttttgcacttgtaccatactataatactctgtcatacctcagaaaggaaagaa
ttgttgaatcttgacaaactggaagcacaacttaaagcttgtaactgccgactagtcttc
tcaaaagcaaaaccatctgtcttggccctgtgccttctctctctggaagtgcagactcta
aagtccattgagttgtttgagattgttctgtgtattcagaagtattcaaagataagtgac
agtgacttactgtattggagagaactggtctcgaaatgcttagcagattattcttctcct
gcctgctgcaaaccagaccataaaaaattagtatggattgtttcaagacgcactgcccaa
aatcttcaaaacagctactatagtgttcctgagttgcccacaattcctgaggttggatgc
tttgatggaagtgagagtgaggattcttgtgaagatatgagctgtggagaagaaagcctg
agcagctctcctccaagcgacctggaaggctccttcttctttgacctcaaaccgaagtca
aagtggccggctctctcctttgactcctag

DBGET integrated database retrieval system