KEGG   Anolis carolinensis (green anole): 100555545
Entry
100555545         CDS       T01608                                 

Gene name
cdk2
Definition
(RefSeq) cyclin dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04110  Cell cycle
acs04114  Oocyte meiosis
acs04115  p53 signaling pathway
acs04218  Cellular senescence
acs04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100555545 (cdk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100555545 (cdk2)
   04114 Oocyte meiosis
    100555545 (cdk2)
   04115 p53 signaling pathway
    100555545 (cdk2)
   04218 Cellular senescence
    100555545 (cdk2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100555545 (cdk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100555545 (cdk2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acs03032]
    100555545 (cdk2)
   03036 Chromosome and associated proteins [BR:acs03036]
    100555545 (cdk2)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100555545 (cdk2)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100555545 (cdk2)
DNA replication proteins [BR:acs03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100555545 (cdk2)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100555545 (cdk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DHC_N1 Haspin_kinase APH Kinase-like
Other DBs
NCBI-GeneID: 100555545
NCBI-ProteinID: XP_008112629
Ensembl: ENSACAG00000005404
UniProt: H9GA76
LinkDB
Position
Un
AA seq 299 aa
MENFQKVEKIGEGTYGVVYKAKNKITGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDSSSSISGVELPLIKSYLYQLLQGLAFCH
SHRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKY
YSTAVDIWSLGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTPDETVWPGVTSMPDYKSS
FPKWARQDFSKVVPPLDEEGRKLLAQMLHYDPNKRISAKTALSHPFFRDVTKAVPHLRL
NT seq 900 nt   +upstreamnt  +downstreamnt
atggagaacttccagaaagtggagaagatcggcgagggcacctacggggtggtctacaag
gccaagaacaaaatcacgggcgaagtggtggccctgaagaagatccgcctggacacggaa
acagagggagttccaagcacggccatccgggaaatctcactgctaaaggaattgaaccac
cccaacattgtcaaacttctggatgtgatccacaccgaaaacaaactttacttggtcttt
gagttcctacatcaggacctaaagaagttcatggattcttcatcatcaatcagtggtgta
gagttaccccttattaagagttatctgtaccagctgcttcagggccttgccttttgtcac
tcccatcgcgtgctccaccgtgacctgaaaccacagaacctcctgatcaatgctgaggga
gcgataaaactggcggactttggacttgctcgtgcttttggggtgccagtacggacttac
acacatgaagtggtcaccctctggtatcgtgctccagaaatcctccttggctgcaaatat
tattcaactgctgtagatatatggagtctgggctgcatctttgctgaaatgctaacgcgt
agagccctttttcctggggattcggagattgaccagctgttccgcatatttcgcacattg
ggcacacctgatgaaactgtatggccaggcgtcacttccatgcctgactacaagtccagc
ttccctaaatgggcccggcaggatttcagcaaggtggtgccgcctttggatgaagaaggc
aggaagcttctggcgcaaatgctgcattacgatcccaacaagagaatctcagccaaaaca
gccctcagccaccctttcttccgggatgtcacaaaagctgtgccgcacctccgcctgtaa

DBGET integrated database retrieval system