KEGG   Anolis carolinensis (green anole): 100555671
Entry
100555671         CDS       T01608                                 

Gene name
cntd2
Definition
(RefSeq) cyclin N-terminal domain containing 2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04110  Cell cycle
acs04114  Oocyte meiosis
acs04115  p53 signaling pathway
acs04218  Cellular senescence
acs04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100555671 (cntd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100555671 (cntd2)
   04114 Oocyte meiosis
    100555671 (cntd2)
   04115 p53 signaling pathway
    100555671 (cntd2)
   04218 Cellular senescence
    100555671 (cntd2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100555671 (cntd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acs03032]
    100555671 (cntd2)
   03036 Chromosome and associated proteins [BR:acs03036]
    100555671 (cntd2)
DNA replication proteins [BR:acs03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100555671 (cntd2)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100555671 (cntd2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100555671
NCBI-ProteinID: XP_016850309
LinkDB
Position
f
AA seq 395 aa
MWGKPTASLPTSPWSGLQRGVADEKREPLKSKDNKGLNSEQGCRKKKKVPGSNEKELTSE
KLGVICPRTLPEAPLQRVIPASESLAKELSQAMLRMNMGLEREYAYDIFSSMMQKQHLYA
FQAFDLPHSITPEMRALGIDLTKKKKKAGILRDRPMLCCLCHCPHLDICLYQDYFGLPDE
TLYLTVYLMNAYMKAGKVRILSLQLLGIACLFVACKVEVSTCPEPNKLCFMTQDSFSWKE
LLRMERKILTRLKFELHYANPVHLLHWMAEVAHSTLEVQYLARYFLELSLMEVDCVCFEP
AQLALAALHLAQRLFLQERSTKEMSQEGSCKLHTYSESELSAVYPYMAKAALRGPNSPLR
ATFLKYSRPQKLCISTSFDITASESLSRCLGSPIS
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtggggcaaacccacagcatcccttcccacaagcccttggtctgggctgcaaagaggg
gtggcagatgagaaaagggagccgttgaaaagcaaggacaacaaaggtttgaatagcgaa
caaggatgcagaaagaagaaaaaggtcccaggaagcaatgaaaaagaattgacatctgag
aagctgggcgtcatctgtcccaggactcttccagaagcccctctgcaaagagtcattcct
gcctcagaatccctcgctaaggaactgtcccaagccatgctgcgaatgaatatgggccta
gagagggaatatgcttacgacatcttcagcagcatgatgcagaagcagcatttgtatgcc
ttccaagccttcgacttgccacactccatcacaccggagatgcgtgcgcttggcattgac
ttgacaaaaaaaaaaaaaaaggcaggcatcctcagagatcgccccatgctctgctgccta
tgtcactgtccccacctggacatctgtctctaccaggactattttggtctgcctgatgag
acactctacctgacagtctacctgatgaatgcctacatgaaagcaggcaaggtgcgcatc
ctcagccttcagctccttggtattgcttgcctcttcgtggcctgcaaggtggaagtcagc
acttgcccagagccgaacaagttgtgcttcatgacgcaggactcgtttagctggaaggag
ctgctacgcatggagcgcaagatcttgacccgcctgaagtttgaactacattatgccaac
cctgtccacctgctccactggatggcagaagtggcccattccaccttggaggtacagtac
ctggcccggtatttcctggagctctctctgatggaggtggactgtgtgtgttttgagcct
gctcagctggccctggcagccctacacttggcacagcgcttgtttcttcaggagaggagc
accaaggagatgtcccaggaaggctcctgcaaactccacacatacagtgagtctgagctg
tctgctgtgtatccctatatggccaaggccgctttgcgaggaccaaactctcccctccgt
gccactttcctgaaatactcccggcctcaaaagctctgcatcagtaccagctttgacatc
acagcctccgagtctctaagtcgctgcctggggagtcccatctcatga

KEGG   Anolis carolinensis (green anole): 100557278
Entry
100557278         CDS       T01608                                 

Gene name
ccnb1
Definition
(RefSeq) cyclin B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04110  Cell cycle
acs04114  Oocyte meiosis
acs04115  p53 signaling pathway
acs04218  Cellular senescence
acs04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100557278 (ccnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100557278 (ccnb1)
   04114 Oocyte meiosis
    100557278 (ccnb1)
   04115 p53 signaling pathway
    100557278 (ccnb1)
   04218 Cellular senescence
    100557278 (ccnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100557278 (ccnb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acs03032]
    100557278 (ccnb1)
   03036 Chromosome and associated proteins [BR:acs03036]
    100557278 (ccnb1)
DNA replication proteins [BR:acs03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100557278 (ccnb1)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100557278 (ccnb1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_C_2
Other DBs
NCBI-GeneID: 100557278
NCBI-ProteinID: XP_003216393
Ensembl: ENSACAG00000016419
UniProt: G1KSK4
LinkDB
Position
2
AA seq 408 aa
MALRVTRNTKVNMENKTKPALAATKSVVGVAKPILRSRTALGDIGNKACEAKPKDAAKKE
TLNPAVVEKVTIRKTTRPVEKTIAPVKEEKPVPEPIQVRPPSPSPMETSVSEPGEEILCQ
AFSDVLLEVNDVDTEDGCDPYLCSEYVKDIYNYLKDLESQQAVRPSYLVGQEVTGNMRAI
LIDWLVQVQMKFKLLQETLYMTVGIIDRFLQDNKVAKRMLQLVGVTAMFVASKYEEMYPP
EIGDFAFVTDQTYTKLQIRQMEMKILQSLDFNLGRPLPLHFLRRISKIAEADIQQHVLAK
YLMELSLVDYEMVHYPPSQIAAAAFCLSSRVLEEGEWTSTLQHYMNYAEIDLVPVMQHMA
RNVVLVNKGLAKHMTVKNKYSSSKHAKISALPALNSGVIQDLAKPLLK
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcgttgcgggtgactcggaacacaaaagtcaacatggagaacaaaaccaagcctgca
ttggcagccaccaagtcagtggtcggagttgccaagcccatcttgaggtctaggactgcc
ttgggagacattggcaacaaggcctgcgaagcaaagcccaaggacgctgccaaaaaggaa
acactaaatcctgcagttgtggagaaagttaccattcgaaaaactacaagaccagttgaa
aagactattgcgcctgtaaaggaagaaaagccagtcccagaacctattcaggtgaggcct
ccctcccctagccccatggagacttctgtttctgaaccaggggaggagatcctgtgccag
gctttctccgatgttcttctggaagtgaatgatgttgatacggaagacggttgcgaccca
tacctctgcagtgaatatgtgaaggatatctacaactatctcaaagatcttgagagtcag
caggcagtgagaccaagctacttggtaggccaggaggtcactggaaacatgagggcaatc
ctaattgactggcttgtgcaagtccaaatgaagttcaagctcttgcaagagactttgtac
atgactgttggaataattgatcgttttctgcaggacaacaaagtagctaagaggatgctg
cagctggttggtgtaacagccatgtttgttgccagcaaatatgaagaaatgtatcctcca
gagattggtgactttgcctttgtgactgatcagacttacaccaaactccagatcagacag
atggagatgaagatcctacaatctcttgatttcaacctgggtcgccctcttcccctgcac
tttctacggaggatctcaaaaattgcagaggcagatatacaacaacacgtactggcaaaa
tatctgatggaactctcactggtggattatgaaatggtacactaccctccttctcagatt
gctgctgcagccttttgtttatcctctagagttcttgaagaaggggagtggacatcaact
ctgcaacactacatgaattatgctgagattgatcttgttcctgttatgcagcacatggcc
aggaatgtagtgctggtaaacaaaggccttgcaaagcacatgactgtcaagaacaagtac
tcaagcagcaagcatgcgaagattagcgcccttcctgcactcaattctggagtcatacag
gatctggctaaaccattactgaaatga

DBGET integrated database retrieval system