KEGG   Anolis carolinensis (green anole): 100555807
Entry
100555807         CDS       T01608                                 

Gene name
siah1
Definition
(RefSeq) siah E3 ubiquitin protein ligase 1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04120  Ubiquitin mediated proteolysis
acs04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100555807 (siah1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100555807 (siah1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100555807 (siah1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:acs04121]
    100555807 (siah1)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100555807 (siah1)
Ubiquitin system [BR:acs04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    100555807 (siah1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 100555807
NCBI-ProteinID: XP_003222961
LinkDB
Position
c
AA seq 313 aa
MTGKSAFSFLYAWKGVLDTCLPGNKASKRKEMSRQTATALPTGTSKCTPSQRVPALTGTT
ASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEK
VANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLM
HQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIV
QLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAE
NGNLGINVTISMC
NT seq 942 nt   +upstreamnt  +downstreamnt
atgacggggaaatctgccttcagttttttatatgcgtggaaaggagtccttgatacatgt
ctgccaggaaataaagccagcaaaagaaaagaaatgagtcgccagactgctacagcactt
cccacgggtacttccaagtgtacgccgtcccagagggtccctgcgttgactggcaccacc
gcttccaacaatgacttggccagtctctttgagtgtccggtgtgttttgactatgtgctc
ccaccgattctgcagtgccaaagtggccaccttgtctgtagcaactgtcgccccaagctc
acatgctgcccaacctgccgaggcccactcggttccatccgtaatttggctatggaaaaa
gttgccaactctgtactgtttccctgcaaatacgcctcctctggctgtgagataacttta
ccccacactgagaaagcagaccatgaagagctttgtgaatttaggccttattcgtgtcca
tgccctggtgcttcttgtaaatggcaaggctctctggatgctgtcatgccccatctcatg
catcagcataagtcgataacaacattgcagggagaagatatagtttttcttgctacagac
attaatcttccaggggctgtggactgggttatgatgcagtcttgctttggctttcacttc
atgttagtactggagaaacaggagaaatatgatggtcaccagcagttttttgcgatcgta
cagctgataggaacccggaagcaagctgaaaattttgcttaccgccttgagctaaatggt
cataggcgacgattgacttgggaagcaacgcctcgatcgattcatgaggggattgcaact
gccattatgaacagtgactgtctagtctttgacactagcattgcacagctttttgcagag
aatggcaatttagggattaatgtgacaatttcaatgtgttga

DBGET integrated database retrieval system