KEGG   Anolis carolinensis (green anole): 100555819
Entry
100555819         CDS       T01608                                 

Gene name
sfn
Definition
(RefSeq) stratifin
  KO
K06644  stratifin
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100555819 (sfn)
   04115 p53 signaling pathway
    100555819 (sfn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100555819 (sfn)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100555819 (sfn)
  Exosomal proteins of colorectal cancer cells
   100555819 (sfn)
  Exosomal proteins of bladder cancer cells
   100555819 (sfn)
SSDB
Motif
Pfam: 14-3-3 Peptidase_C98
Other DBs
NCBI-GeneID: 100555819
NCBI-ProteinID: XP_003227508
Ensembl: ENSACAG00000016687
UniProt: H9GNH2
LinkDB
Position
Un
AA seq 246 aa
MARNHQVQKAKLAEQAERYEDMADFMKAVVEDGSELSNEERNLLSVAYKNVVGCQRSAWR
VISSIEHKTEEGDDKAQLVNEYREKIEKELKNVCNVVLGLLDKHLIPKAGDAESKVFYLK
MKGDYFRYLAEVAAGDDRKQIIDNARKAYQEAMDISKKEMQPTNPIRLGLALNFSVFHYE
IANAPEDAIKLAKTTFDEAMGDLHTLSEDSYKDSTLIMQLLRDNLTLWTAECSGEEGGEA
GEEPKN
NT seq 741 nt   +upstreamnt  +downstreamnt
atggcaaggaaccaccaagtacagaaggccaagctggccgagcaggccgagcgttacgaa
gacatggccgacttcatgaaggcggtggtggaggacgggtccgaactctccaacgaggag
cgcaacctcctctcggtggcttacaagaacgtggtgggctgccagaggtctgcctggagg
gtcatctccagcattgagcacaagaccgaggaaggcgacgacaaggctcagctggtgaat
gagtaccgggagaagatcgagaaggagctgaagaacgtctgcaacgttgtcttaggcctg
ctggacaagcacctcatcccgaaagccggtgacgcagagagcaaagttttctacttgaag
atgaaaggtgactatttccgctacctggccgaggtggctgccggcgatgaccgcaaacag
atcatcgataacgcccggaaagcctaccaagaggcgatggacatcagcaagaaggagatg
caacccacaaaccccatccgcttgggccttgccctcaatttctcggtcttccactatgag
attgccaacgctcccgaagatgccatcaaactggccaagaccacctttgacgaggccatg
ggagacctccacacgctcagcgaagactcctacaaggacagcaccctcatcatgcagctt
ctcagagacaacctcacgctatggacggcggagtgttcaggagaagaagggggagaggcc
ggcgaagagcccaagaactga

DBGET integrated database retrieval system