KEGG   Anolis carolinensis (green anole): 100556055Help
Entry
100556055         CDS       T01608                                 

Gene name
kmt2c
Definition
(RefSeq) lysine methyltransferase 2C
  KO
K09188  histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100556055 (kmt2c)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100556055 (kmt2c)
Transcription factors [BR:acs03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100556055 (kmt2c)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100556055 (kmt2c)
   HMT complexes
    MLL3/MLL4 complex
     100556055 (kmt2c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD FYRC SET zf-HC5HC2H zf-HC5HC2H_2 FYRN HMG_box
Motif
Other DBs
NCBI-GeneID: 100556055
NCBI-ProteinID: XP_016849716
Ensembl: ENSACAG00000014195
LinkDB All DBs
Position
6
AA seq 4977 aa AA seqDB search
MATEEQSPAPEEKKQQQKQQQQQGPPPPPPPPPAPLPQRLLLLPELGSPPSAAADKRPRG
RPRKDGASPFQRVRKKPRSRGKSAVEDEDSMDGLEAAETENTVETEIKEQSPEEEAQAEE
DGDKKLTQTLQSSVSGEPASPVASVGVEAKTSDRLCAFCYCGERSSLGQGELKQYCPTPG
FLAPWSSQPLNKSETGDSHDGICESTPRQNSDLHKSRGQRKEKSHQSITPCTSISTQTTP
DDQIVKFWDELRMVGLPDDIDVQALFEPTGHCWAHHRCAEWSLGVCQTEEQLPVNVDKAV
VSGSTKRCAYCKHLGATIKCCEEKCTQMYHYPCAAGAGTFQDFNNFSLLCPDHIDQAPLR
SKEEANCAVCDSPGDLLDQLFCTTCGQHYHGMCLDIQVTALKRAGWQCPDCKVCQNCKHS
GEDNKMLVCDTCDKGYHTFCLQPVMDSVPTNGWKCKYCRVCAECGTRTSSQWHHNCLMCD
SCYNQQEKLPCPLCEKTSSPDGQKDRLYCHLCRRWIHIECDRSPNNELDSHLKEYVCSLC
KHSIVEEECALSCDAMETAQLLPEPDTGCADEMEIEDSAEGVTNEDQVVTDCGLAEQESL
VKCTADGLSLNENSGELEIQISHNYGADEMETSPQKTHAANGIDIGKKVETTENIPDLMP
QLTGKQTEGKEHTQESIELLNMPKEEPQLPLVTTEDLVKMPGAFILISKERASYQKEEQL
DARVVSEGGNGGETPESCETSSLPASESCATDSSPLGDKSIKSPAETFSSFPSSVEISKT
SVSSSPAASLELGSSHDMLRSQTSSLESALVLPTTYVSLTPKIGMGKPAITKRKFSPGRP
RSRQGAWSSHNTVSPPSWSPDISEGREFFKSRPLPGSAIWSIKVGRGSGFPGKRRPRGAG
LSGRGGRGRSKLKSGIGSIFPPGVMDMDISYIKDEEENSMHNTVVLFSSSDKFTLHQDMC
VVCGSFGKGAEGRLLSCSQCGQCYHPYCVSIKITKVVLHKGWRCLECTVCEACGKATDPG
RLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSPGLRCEWQNNYTQCAP
CASLSTCPICCCNYREEDLILQCRQCDRWMHTVCQNLNTEEEVESTADNGFDCTMCRPYV
LPANVPSTECCESSAAAQILTKAKELDPPKTYTQDGVCLTETGMSQLQSLSAVVQRRKRT
KPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGELMDCEGKSDTSPEREAVDED
PKGIEGTEGIKKRKRKPYRPGIGGFMVRQRSRTGQGKAKRSLSRKDSSGSISEQIPSKDE
SWGEQPPGTPVDETTPVSENVEKNKKRYRKKKNKLEETFPAYLQEAFFGKDLLDTSRQSK
PSLDHLGEENLNISCKTNLSTSFLDPSSDPLLSSTSTPVPSKAGTQGIADDPIAALVLNN
DDDILGIFSDDLVKSADHSGLDLCTFQVESSSSPFAGLDIGAISDDPSSLPLQSVSQSSR
PLSEEQLDGILSPELDKMVTDGAILGKMYKIPELGGKDVEDLFTAVLSPANTQSTPLPQP
QPPTPQPLMHLHNPGESTFSRVPLMNGLIGPNPHLPHASLVPGGGLGAFPTISQPPFTDT
RDKNAFNAVMNDPTGSWVPSAAPLEGEGDTMSNAQRSTLKWEKEEALGEMATVAPVLYTN
INFPNLKEEFPDWATRVKQIAKLWRKASSQERAPYVQKARDNRAALRINKVQMSNDSMKR
QQQQDSIDPSSRIDAELFKDPLKQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKN
EQQQLQQQLGSQQPLNQSGSDTPSSGMQSPLTPQTGNGNMSPGQQTLYTKQPSGTPSSSP
PSDVFLKPQVPPPPVTPNKMPGQDTHSQASSQHSFSPSSSARPPSPIDPYAKMVGTPRPL
PVNQNQNYIRRNSVPSVDFCPPPSPISRPAQAPEIAGKRPSPGRDSCSLSPVNIDPYAKA
PDTPRPVMGTEQFAKPMGVSRSSLMAEQPGKASLNVSNSDPFAKPPPRADGFPRPRMPLA
DSYARPPLTSILVAEESSGPFKTPFRPNQPPQDPYTKMPLTPRRLPLDPYERPVLTPRPV
DSFSHNPSNDQYTQPLTPQPAIKETFAHPQRVIRSQSDAFSQSGTGSRAVAQDPYAQPPG
TPRPVSDPYAQPPGTPRPVSDPYAQPPGTPRPVTDPYAQPPGTPRPITDPYAQPPGTPRP
VSDPYAQPPGTPRPSTVDPYMHQPHPPRPAQKADLFPQVSATQRHSDPYAQPPGTPRPMS
NDPYSQSPATPRPIVSETYNRPTLMLNRDPYLQTSQNKPFVRPSDTCSQPTKLSGSVVAD
TFSHIPTAPSCDSYDQPPRTPRPQPESFGNAQHPHDAAEQPRPGSGGSFHAPVNASVNLQ
GNPFPQTTQVPGPAPTAGATSTQNTMSQAEAEKLRQRQKLREIILQQQQQKKNAIRQEKA
PQEPAASHTGAIPPWPQENLNQIFNRPPPPYPGNVRASIVPPSGMRFTVFPAEGQFNRPQ
FPGDMAGMGMRPHGIRYGFPGSGHGPPPCPERFLGPPQQMQRPGIPPQLRRPMPIDMPRL
PTKPQMANPIALPQHFPPQGIQVQQHNIMGQAFIELCHRAPESRPRLPFNSPPTTVINAV
PQHQQHGGFLPRQDCQGPRLLEPMRHNSQNLNTPLHVSTGLEHLPPPQQETMNPSHPPVL
VMCSLSSPPVNDAFPGGSLPEATAAESASDLQIPNQTAEVLEEKLDPDDPSVKDLDVKDL
DGVEVKDLVDEDLENLNLDPEDGKGDELDTFDPLETNDRHLDDLLRSGEFDIIAYTDPDH
DLGDKKGMFSEELDLNVPIDDIQGRGEDTQQNHQDDKVPSPGDSLPSQNKTGEVSEIKTE
VLSPNTVAESNSENEKGDRNVTASSTQHMAEPELHDGETKSVLTCNVEIIDKTTTKEEST
ASSPDAAQGTAPTPSQSIASSCNISGSTPVLTSLLSNESSDNTDVGTSASPANSLPAAQA
NPVPGIPQTLLTSAGQTVENALPNMNIVPQISHSFSPGTTVNPGFVPGQPASHSFGPGQP
GNQTVPVVNRPGPTGLPGPQQMMLPQTLAQQQNRERPLLLEEQPLLLQDLLDQERQEQQQ
QRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVALKGINKVMAQNNMGMPPMVMNRFAF
MGQAVPGAQTGEGQNLIQQAITQDGNLTPQMSRPNPPNFGPGFVNDSHRKQYEEWLQETQ
QLLQMQQKFLEEQIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQQSMVQKQL
EQIRKQQKEHTELIEEYRIKQQQCGMGPHAMMPGMPSQPPMVPGASPPSMGQQNFPVVPQ
LQHQQHTVVVPGQPTPPRMPGLPGWQPPGAAQMHVPHNAPRMPPPMTPLPVNTVPPAPVP
APTSSVQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVDRQRALQQRM
EMEQHGAVGSELNARTSLPQMPYFNPDLPCDFMRPSQSLPQSPQHQQPQMGPLIQQGPGP
LNSPPAANFPQCSEQQPMGSSPFGPDSAPVPDGSPTFHSVKQPLGSISGANFTQCQVRPQ
FASGLPPVPLAAGNGPPCGPDTSMPHGPNFPETSQSLIQLYSDIIPEEKGKKKRTRKKKK
EEDTESVKTPSTPHSDITAPPTPLVSDPVSTPAVSTPGEHACHPGETEAEEVPGSSTPNA
AESQSSLESKGQLSSSDLSQNKLPEPSSTKPETDAVKADASQGTQEITQEDTEGDPCPSQ
PKLKVEGQSNIKVEEDKAATQTTHSSQNPGQDASIPAAKGESGNELLKHLLRNRKSTTCI
SPKSDSTFPSEEGAEENKFVEKQDPAEGGMQSIGNPLQGTFGCGNNQISRADIGQEMKKQ
RNKRTQRAGEKATPRTKRRKKEEEEKQAIYPNTETFMQLKQQLSLLPLMEPIIGQNNLSN
PPTPPASLPPTPPPVTCQKMVNGFATTEELATKAGMLGGHDVTKALGPKQFQLPFRPQDD
LLARAMAQGPKSVDVPASLPTPPHNNHEELRVQDPCDDRDTPDSFVPSSSPESVMGMEIS
RYPDLAAVKEEMPEPIPSPIIPILPASTGKGLETKRNYIKTEPGPGFFGSQIGSSPNVPR
SGYVSIAITLHPAAAENIGSVVAAFSNLLHVRIPHSYEVSSVSDVPASMGMINAHKSNPA
FEYRQHLLLHGPQPGTIGPPGLTGPYGLKQHSMSFPPSGNVLAGYKAHNPNVIDGSALRP
QWCSHCKVVILGSGVRKSFKDLPLLKQDSREKTERMEKDLFFCSNNCFVLYSASMQAKKL
DSKESIPSLTQFPAKEVPPKVFHQYNNNISTLDVHCLPQFQEKASPPSSPLIIFPPAFEA
ARVEPKPDELKVTVKLKPRLRTIPNGLDDSRPASKKWKGMKWKKWNIQIVIPKGTFKPPC
DEEIDEFLKKLGTTIKPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALW
STEVYETQAGALINVELALRRGLQMKCTFCHKMGATSGCHRLRCTNIYHFTCAIKAQCMF
FKDKTMLCPMHKPKGVHEQELSYFAVFRRVYVQRDEVRQIASIVQRGDREHTFRVGSLIF
RTPSDSSCRIRCRPFHSSRVLYPVGYEASRLYWSTRYANRRCRYLCSIEEKDGLPLFIIR
IIEQGHEDVVLTDATPKGVWDQILEPVASVRKTSEMLQLFSAYLKGEDLFGLTVSAVARI
AESLPGVEACERYTFRYGRNPLMELPLAINPTGCARSEPKMSSHVKRFVLRPHTLNSTST
SKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKH
TMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRIDNDHVIDATLTGGPARYINHSCAPN
CVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKWMN
NT seq 14934 nt NT seq  +upstreamnt  +downstreamnt
atggccacggaggagcagagcccggcgccggaggagaagaagcagcagcaaaagcagcag
cagcagcaagggcctcctcctcctcctccaccaccaccagcacctcttccacaaagactt
ctccttctccccgagctcggctctcccccctcggcagccgcagacaaaagaccaaggggc
cggcctcgcaaagatggcgcttcccctttccagagagtcaggaagaagcctcgaagtaga
ggaaaatctgcagtggaggatgaagacagcatggatgggttggaagcagcagaaacagaa
aacactgtggaaaccgaaatcaaggaacagtctccagaggaggaagcccaagctgaagag
gatggtgataagaagctaacacaaactcttcagagctcagtttctggggaacctgcaagc
cctgttgcctctgttggtgttgaagcaaaaaccagtgaccggctctgcgccttttgctac
tgtggggagcgaagttcattaggacaaggagaactgaaacaatactgtccaacaccaggg
tttcttgcgccatggagcagccagcctttaaataagagtgaaactggggacagccatgat
ggcatttgtgagagtactccaaggcagaactcagacctgcacaaatcaagaggacagagg
aaagagaagtctcatcagagtataacaccttgtacaagtataagcactcaaactactcct
gatgatcagatagtcaagttctgggatgaactcagaatggttggcttaccagatgacatt
gatgtccaagccttatttgagcccacaggccactgctgggctcatcaccgctgtgcggaa
tggtcgctgggcgtttgccagactgaagagcagctaccagtgaacgtggacaaagctgtt
gtctcagggagcacaaaacgatgtgcatattgcaagcaccttggagccactatcaaatgc
tgtgaagagaaatgcacccagatgtaccattacccatgtgctgctggagcaggcactttt
caggattttaataacttttccctcctttgcccagaccacattgaccaggctccactaaga
tcaaaggaagaagctaactgtgcagtttgcgatagtcctggcgaccttttagatcaactt
ttttgtactacttgtggccagcattaccatgggatgtgtctggatatacaagtgacagct
ctaaaacgggcaggctggcagtgtcctgactgcaaagtgtgccagaactgcaagcattca
ggagaagataacaagatgctagtatgcgatacatgtgacaaaggataccacacgttctgt
ttacaaccagttatggactctgtaccaacaaatggctggaaatgtaaatattgcagggta
tgtgcagaatgcggcacacggaccagtagccagtggcatcacaactgtcttatgtgtgat
agttgctacaatcagcaggagaagctgccttgtcctttgtgtgaaaagacctcctctcca
gatggacaaaaagacaggctgtattgtcacttgtgcagaaggtggattcacatagaatgt
gacagatctcctaataatgaactggatagtcatctgaaagagtacgtctgcagtctttgc
aaacattcaatagtcgaagaggaatgtgcgctgtcatgtgatgcgatggagacggcccaa
cttcttcctgaacctgacacaggttgtgcagatgaaatggaaatagaggatagtgcagaa
ggtgtcacaaatgaagatcaagtagtaacagattgtggcctcgctgaacaagaatcactg
gttaaatgcactgcagatggcctctcattaaatgaaaacagtggtgaactggaaatacag
atttctcataattatggtgcagatgaaatggaaacatctcctcaaaagactcatgcagca
aatggtattgacattggtaaaaaagtggaaacaacagaaaatattccagatctgatgcca
caattaacgggaaagcaaactgagggaaaagaacatacacaggaaagtattgaattacta
aatatgcccaaagaagagcctcagcttcctctagtaacaactgaggacttagtaaagatg
cctggtgctttcattttgatcagtaaagagagggcttcctatcagaaagaagagcagttg
gacgcaagggttgtgtcagaaggtgggaatggaggtgaaactcctgaaagttgtgaaaca
tcatctcttcctgcaagcgaaagctgtgcaactgacagttcacccttgggagacaagtct
attaagtcacctgcggaaacattctcttcattcccatcatcggttgaaataagcaagaca
agtgtgtcttcctcaccagcagcctcgctagagttgggctcctcccatgacatgctccgt
agtcagacatcatcactagaatccgctctggttcttccaaccacctatgtctcactcact
ccaaaaattggaatggggaaaccagctatcaccaaaaggaagttttctcctggaagacca
aggtcaagacagggggcttggagtagccataatacagtgagcccaccttcctggtcccca
gacatttcagaaggtcgggaattttttaaatccagaccgttacctggcagtgccatatgg
agcatcaaagtgggtcgtggatcaggattccctgggaagcggagaccacgtggtgcaggt
ctttcaggccgaggtgggcgagggagatcaaaactcaagagcggaattggatctatcttt
cctccaggggtcatggatatggacatttcttatatcaaagacgaggaggaaaactcgatg
cacaataccgttgtcttattttctagcagtgacaagtttactttgcatcaggatatgtgt
gtagtttgcggaagttttggtaaaggcgcagaaggacgattgctgtcttgttctcagtgt
ggtcagtgttaccatccctactgtgtcagtattaagattacaaaagtggtactccacaag
ggttggagatgcctggagtgcactgtgtgcgaagcctgcgggaaggcaacggatccagga
aggctactcctttgtgatgactgtgatatcagctatcacacatactgcctggatccacct
ctgcaaaccgttcccaagggaggttggaagtgcaaatggtgtgtttggtgcagacactgt
ggcgctacttctcctggtctgagatgtgaatggcaaaataattacacacagtgcgctcct
tgcgcaagtttatctacctgcccaatctgctgttgcaattatagagaagaagaccttatt
ctacagtgtagacagtgtgacagatggatgcacacagtctgccaaaacctaaacacagag
gaggaagttgaaagcacagctgacaatggttttgactgtaccatgtgtaggccatatgta
ctaccagcaaatgtgccttccacagaatgctgtgaatcatcagctgcagcccaaatttta
acgaaagcaaaggaacttgacccaccgaagacatacactcaggatggagtctgtttgaca
gaaacagggatgtctcagttacagagtcttagtgcagttgtacaaagaagaaaacggacc
aagccaaagctcaaattgaagattataaaccagaatagtgtggctgtgctccaaacacca
cctgacatccagtcagaacactcaagggatggggagatggatgacagtagagaaggagag
ctcatggactgtgaaggaaaatcagacacaagcccagagcgggaagctgtcgatgaagat
cccaagggaatagaaggaacggaggggatcaaaaagcggaagagaaaaccataccgacct
ggcattggtggattcatggtacggcagcggagtcgcacaggacagggaaaagcaaagcga
tctctctctaggaaggattcttctggctccatctctgaacagatacctagcaaagatgaa
agttggggtgaacagccaccaggcacaccagttgatgaaaccactcctgtttctgaaaat
gtagaaaaaaataaaaaacgctatagaaaaaagaaaaacaagcttgaagagacctttcca
gcctacctgcaggaagccttcttcggtaaagatcttctggatactagcagacaaagtaaa
ccaagtttagatcatttgggtgaagaaaaccttaacatttcatgcaaaacaaatctgagc
acaagcttcttagatccatcttcagacccccttcttagctcaacttccacgccggtgcca
tcaaaagccggcacacaaggtattgctgatgacccaatagctgctcttgtgctgaataat
gatgacgacattcttggaatcttttctgatgatttagtgaaatcggcagatcattcaggt
cttgatttatgcactttccaggttgagagctcatcctccccttttgctggtctggatatt
ggagccatctctgacgatccctcttctctgcctctacaaagcgtcagtcagagttcacgg
ccgttgagtgaagaacaattagatggaatcctgagccccgaattggacaagatggtcaca
gatggtgcaattcttggtaaaatgtacaagattccagagctgggaggaaaggatgtggaa
gacctgtttacagctgtgctgagtcctgcaaatactcaatcaacacctttgccacaaccc
caaccacccacaccccaacccttaatgcacttgcacaatccaggagaaagcacgttttca
agagttccacttatgaatgggctgattggaccaaatccccatctccctcatgcatcttta
gttcctggaggtggattaggtgcttttcctaccatatcacagccaccgttcacagacacc
agagataaaaacgcctttaatgctgtgatgaatgatcccacgggctcatgggttccatcc
gcggcccctctggaaggtgaaggtgacaccatgtctaatgcacagagaagcactctgaag
tgggagaaagaggaagcacttggtgaaatggcaaccgtcgcacctgttctgtacacaaat
atcaactttccaaacctgaaagaggagttcccagattgggccacaagagtgaagcagatt
gccaaactgtggagaaaagcaagttcgcaggaaagagctccatatgtgcaaaaagccaga
gataatagagctgccttgcgcatcaacaaagtgcagatgtctaatgattccatgaaaagg
cagcagcagcaggacagtattgatccaagctctcgtattgatgccgaactcttcaaggac
ccattaaagcagagagaatcagagcatgagcaagagtggaaatttagacagcaaatgcgt
caaaaaagtaagcagcaagctaaaattgaagcaactcagaaactagagcaagtgaaaaat
gagcaacagcaacttcagcagcaacttgggtcacagcagcctttgaaccagtcaggttca
gatacgcctagtagtgggatgcagagccctttaactcctcagactggtaatgggaatatg
tctcctggtcagcaaacattatacacaaagcaaccatctggcaccccttcttcttctcct
ccatctgatgtgttcctgaaaccacaagtcccacctccacctgtgacaccaaacaaaatg
cctggtcaggacacacactcacaggcttcatctcaacactctttttctccttcttcatct
gctagaccaccttctcctattgatccatatgcaaaaatggtcgggactcctaggccacta
cctgttaaccaaaatcagaactatatcagaagaaactctgttccatccgttgatttctgc
ccacctccatcacccatatctaggccggctcaagctcccgaaatagcaggaaagcggcca
tcaccaggcagagattcatgttctttgtctccagtcaacatcgacccttatgcaaaagct
ccagatacacctagacctgtgatgggaacagaacagtttgccaagcccatgggggtgtca
agatcatctctaatggcagaacagccaggaaaggcatctttaaatgtatcaaacagcgac
ccatttgctaagccacctcccagggcagatggatttccaaggcctcggatgcctctggcc
gactcatatgcacgacccccattgacttccattcttgttgctgaggagagttctggtccg
tttaaaactccattccgcccaaatcagccaccacaagatccttatacaaaaatgccactg
actccgagacgcctacctttggatccctatgaacggcctgttttaacaccaaggcctgtc
gatagcttttcgcacaatccatctaacgaccaatacactcaacctctgactccacagcca
gcaataaaagagacttttgcccatccacaaagagtaattcgaagccagagtgatgctttt
tctcagtctggaactggttcaagggcagttgctcaggatccctatgcccagcctccgggt
actcctcgtcctgtctcagacccatatgcccaacccccgggtactcctcgtcctgtctca
gacccatatgcccaacccccgggtactcctcgtcctgtcacagatccttatgcccaacct
ccaggtactcctcgtccaatcacagatccttatgcccaacctccaggcactcctcgtcct
gtctcagacccatatgcccagcctccgggtactcctcgcccttccacggttgacccatac
atgcatcagccacacccaccaagacctgcccagaaagcagacttgtttcctcaggtttca
gctactcaaaggcattctgatccatatgcccagcctccaggaacaccaagaccaatgagt
aatgatccgtattctcagtcaccagcaactccaaggcctatagtttcagaaacatacaat
cgacccacactcatgttaaatcgagatccttatctacagacttcacagaataagcctttt
gtaagaccatcagatacatgttctcagcccacaaagttatcgggatctgttgtggcagat
acctttagccatattccgacagccccatcttgtgattcttatgatcagcccccaagaacc
ccaagacctcaaccggaaagttttggaaatgctcaacatccccatgatgctgctgaacag
cccagacctggatcaggggggagcttccatgcacctgtgaatgcctctgtgaacttgcag
ggaaatccatttccccagaccacgcaagttcctggcccagcaccaactgcaggagcaaca
agtacgcagaacacaatgtctcaggcagaggcagagaaactgagacagcgccagaaattg
cgtgaaattattcttcagcagcagcaacagaagaaaaatgcaatccgtcaagagaaagca
ccacaggaaccagcagcatctcatacaggagctattccaccttggccacaagagaatctg
aaccagatttttaaccgtcctcctcctccataccctggaaatgttagggcatctattgtc
cctcccagtggaatgaggttcaccgtttttcctgctgaaggacagttcaatagaccccag
tttccaggagatatggctggcatgggaatgaggccccatggaattaggtatgggtttcct
ggaagtggtcacggaccccctccatgtccagaacgcttccttggtcctccacagcaaatg
caacgtcctggcatcccaccacagctcagaagacccatgcctatagatatgcctagatta
cccaccaaacctcaaatggctaatcctattgcacttccacagcatttcccaccacaaggc
attcaggttcagcagcacaacattatggggcaggcatttattgaactctgtcacagagcg
cctgaaagccggccaaggctgccttttaattctccaccgacgactgttataaacgcggtt
ccccagcatcagcaacatggagggtttttacccaggcaggactgtcagggccccagactc
ctggagcccatgagacacaattctcaaaaccttaacactccattgcatgtgtcaacaggc
ttggaacatttaccaccacctcagcaggaaacaatgaatccaagccatccgcctgtgcta
gtgatgtgttctctaagtagtccaccagttaatgatgcttttccaggaggatctttgcca
gaagcaaccgctgccgagtcagcaagtgacttacagattcccaaccagactgctgaggta
ctagaagaaaagcttgatcctgatgatccttctgtgaaagatttagatgtcaaagacctt
gatggtgtggaggttaaggatttggttgatgaagaccttgagaatcttaatctagatcca
gaagatggcaaaggagacgagctggacacatttgatcctcttgaaactaatgatcgccac
ctagatgaccttctgagatcaggagaatttgacattattgcttacactgatccagaccac
gatttaggtgacaagaagggtatgtttagtgaggagctggatctcaatgttcccatagat
gatatacaaggcagaggagaagacacccagcaaaaccaccaggatgataaagttcccagc
ccaggagactcacttccttcacagaacaaaactggtgaagtcagtgagattaaaacagaa
gtgttgtctccaaacacagtagctgaaagtaactctgaaaatgaaaaaggtgacagaaat
gtgacagcctcaagcactcagcatatggctgagccagagttacatgatggagaaacaaaa
tctgtgctgacttgtaatgtggaaataattgacaaaacaactacgaaagaggaatccact
gcgtctagcccagatgctgctcaaggcactgctcccacgccatctcaaagcatagctagt
tcttgcaatatctctggatccactccagttctaacaagcttgctttctaatgagagttca
gacaacactgatgttgggacttcagcgtctccagctaactctctgccagcagcacaagca
aatcctgttccaggtattcctcaaacattattgacatctgctggtcaaactgtggagaac
gctttacctaacatgaacatcgttccccaaataagccatagcttctcaccagggacaaca
gtaaatccaggttttgtccctggccagcctgctagtcatagctttgggccaggacagcct
ggcaatcaaacggtgcctgttgtcaatagacccggccccactggactgcctggtccccag
cagatgatgcttcctcagacattggcccagcagcagaatcgagagaggccccttctgctg
gaagagcagcctcttttgctccaagatctcttagaccaagaaagacaggagcagcaacag
caacgacagatgcaagccatgattcgccagcgttcggagccttttttccccaacattgat
tttgatgctatcaccgatcccataatgaaagcaaagatggtggctctgaaggggatcaat
aaagtaatggcacagaacaatatgggaatgccaccaatggtcatgaacaggtttgccttt
atgggccaggcagtgccaggagcacagactggggaaggccagaatctgatacagcaagcc
attacgcaggacggaaatctaacccctcaaatgtctaggccaaatccaccaaattttggt
cctggatttgtaaatgattcacatcgaaagcaatatgaagaatggctgcaagaaacacag
cagcttcttcagatgcagcaaaaattcctcgaggagcaaattggtgcacatagaaaatca
aaaaaagcactctctgcaaaacagcgcacggcaaagaaagctggccgggaattcccagaa
gaagatgcagagcagctcaagcatgttactgagcagcagagtatggttcaaaaacagctt
gaacagatacgaaagcagcaaaaggaacacacagagcttattgaagaatatcggattaag
cagcaacaatgtgggatgggtccccatgctatgatgccgggcatgccttctcagccccca
atggtcccaggagcatcaccgccctcaatgggtcaacagaatttcccagtggtcccacaa
cttcagcaccagcagcatacggttgttgttcctggtcaacccactccgccaaggatgcca
ggcttgcctggatggcagcctcccggtgctgcacaaatgcatgtcccacacaacgcacca
aggatgccccctccgatgacacccctgccagtcaatactgtgccgcctgctcctgtgccg
gctcccacctccagcgtacagtcaggacccccgccacgggtggagtttgatgataataac
ccgtttagtgaaagctttcaagagcgagagcgaaaggagcgcttgcgagagcaacaggaa
aggcaacgcattcagctcatgcaggaggtggaccggcagagagctttgcagcagaggatg
gagatggagcaacatggtgcagtgggctcagaattaaacgccagaacttccttgcctcaa
atgccctacttcaatcccgatctgccttgtgatttcatgcggccttcgcagtctcttccg
caatccccgcagcatcaacagccgcagatgggacccctcattcagcaaggacccgggcct
ttgaattcaccaccagctgccaactttccccagtgtagtgagcagcagcccatgggatct
tccccgtttggacctgattcagcaccagttccagatggaagccccactttccactctgtg
aagcagcctcttgggagcatctcaggagccaactttacacagtgccaagttagacctcag
tttgccagcggtctgcctccagttcctctcgcagctgggaatggtcctccctgtggcccg
gacaccagcatgccccacggcccaaactttcctgaaacaagtcagtctctcattcagttg
tattcggatatcattccggaggaaaagggcaagaagaaacgaacaaggaaaaagaagaaa
gaggaggacacagaatcggtaaagactccatctacacctcattcggatataaccgcacca
ccgactccacttgtttcagatcctgtctccaccccagcagttagcacgcctggtgaacat
gcctgccacccgggagagacggaggcagaagaggtgccaggctcatcaactccaaatgct
gcagagagccagtcttccttagaatccaaaggccagctctctagtagtgatttgtcacaa
aacaaattgcccgagccatcgagcacgaagccagagacggacgcggtcaaagcagatgct
tctcagggcactcaggaaattacccaagaagatacagaaggtgatccgtgccctagtcaa
cccaagctgaaggtagaaggtcaaagcaatattaaagtggaagaggataaagctgcaacc
cagactacacattcttcacagaacccggggcaagatgcaagcatcccagccgcaaaagga
gaatcagggaatgaactcttaaaacacttgcttcggaacagaaaatctaccacttgcatc
agtccaaaatcagacagcaccttcccctcagaagagggagcggaagagaacaaatttgta
gaaaaacaagacccagctgaaggtggtatgcaatcaataggaaatccactgcagggtacg
tttgggtgcggcaacaaccagatttcgagagcagatataggacaagaaatgaaaaaacag
cggaacaaacgaactcagagggccggggagaaggcaacacctcggacaaagaggaggaaa
aaagaggaggaggagaagcaggctatttatcccaacacagaaacatttatgcaattaaag
cagcaactctctttgctgcctttgatggagccaataattggacagaataacctcagcaac
cctcccacgcctccagcctccctccctcccacacctccgcctgtaacttgccaaaaaatg
gtaaatggatttgcaaccaccgaagaacttgccaccaaggcaggaatgctgggaggtcat
gatgttaccaaagctttgggacccaagcagttccagctgcctttcagaccacaggatgat
ctcttggctcgagccatggctcaaggtcctaaaagcgtggacgttcctgcttcccttccg
accccacctcacaacaatcatgaagagctacgggttcaggatccttgtgatgacagagac
actcccgacagctttgttccctcttcctctcccgagagcgtgatgggcatggaaataagc
agatacccggatctggccgcagtcaaggaggagatgccagagccaattccttcccccatc
atcccaatcctacctgccagtactggaaagggtttagaaacaaaaaggaattatatcaaa
acagagcctggccctgggttctttggctctcagattggatcttccccaaacgtcccaaga
tctggttatgtgtccatagcaattactttacatcccgctgctgcagagaacattggcagt
gtggtggctgcgttttccaaccttcttcatgtcaggattccacatagttacgaggttagc
agtgtgtccgatgttccagcctccatgggaatgataaatgctcacaaatcaaatcctgcc
tttgaatacagacagcacttattactacatggtcctcaaccaggcacgataggcccgccg
ggactaacggggccttatggactcaaacaacatagtatgtcgtttccacccagtggtaat
gttttggcaggctataaagcacacaatcccaatgtcatagacggttcggcattgaggccg
cagtggtgctctcattgtaaagtggtcattctgggcagcggagtacggaaatctttcaaa
gatctacctttgctgaagcaggattccagagagaagacagaaagaatggagaaagacctt
ttcttctgcagcaacaattgctttgttctgtattcagcatccatgcaagcaaaaaaacta
gatagcaaggaatcgattccttcgttaacacagtttccagcgaaggaggttccccccaaa
gtgttccaccaatataacaacaatatttctaccttagatgtgcactgcctccctcagttc
caggaaaaggcttctccgccttcctctccccttatcatcttccctcctgcttttgaagca
gccagagtggaacccaaaccagatgaacttaaggtcacggtaaaactaaaaccccgtttg
agaacaattcccaacggtcttgacgacagtcgaccagccagtaagaaatggaaaggaatg
aagtggaagaaatggaatatacagattgtgattcctaaaggaacgttcaaacctccttgc
gatgaggagatagacgagttcctcaagaaactgggcacaacgattaaacccgatccagtt
ccgaaggactaccggaagtgttgcttctgtcacgaagagggcgatggactcacggacggg
ccagcgagacttctgaaccttgacttagacctttgggtccatttgaattgtgccctttgg
tctacggaggtctacgagacacaagctggtgccttaatcaacgtggaactcgccctgcgg
agagggttgcaaatgaaatgcacattctgccacaagatgggcgccaccagcggctgtcac
aggttaaggtgcaccaacatttatcactttacctgcgccattaaagcacaatgcatgttt
tttaaggacaaaactatgctttgcccaatgcacaaaccaaagggcgttcacgagcaggag
ctcagctacttcgccgtcttcaggcgggtctacgtgcagcgcgacgaggtccggcagatt
gccagcatcgtccaacgcggggaccgcgagcacaccttccgggtggggagcctgatattt
cgcacaccatcggacagctcctgccgcatcagatgcaggcccttccattcttccagggtg
ctctacccagtgggctacgaggccagccgcttgtattggagcacgcggtatgccaaccgc
aggtgccgctacctgtgctccatcgaggagaaggatggcctccccctcttcatcatcagg
atcatcgagcaaggccacgaagacgtggtccttaccgacgcaactccaaaaggtgtttgg
gatcaaatcctggagcctgttgcttctgtaaggaaaacctctgagatgctgcagctcttc
tctgcatatctgaaaggggaagacctttttggattgaccgtctctgcggtagcgagaata
gctgaatcactccccggggtcgaggcctgtgagcgttacaccttccgatacggccgaaac
ccgctcatggagctccccctcgccatcaaccccaccggctgcgcccgctctgagcccaaa
atgagcagccatgtcaagaggtttgtgttaaggcctcataccttgaatagcaccagcact
tcaaagtcatttcagagcacagttacaggagaactaaatgcaccttacagtaaacagttt
gttcattcaaagtcctcacaataccggaagatgaagactgaatggaaatccaatgtctac
ttggcacgatcacgaattcagggtctgggcttatatgctgctagagacattgaaaagcac
accatggtcattgaatacattggaaccatcatccgcaacgaggtagccaacaggaaggag
aagctctacgaatctcagaaccgtggagtgtacatgttccgcatcgacaacgatcacgtc
attgatgccacgctgacaggaggccccgcaaggtatattaatcattcctgtgcaccgaac
tgtgtggctgaggttgtaaccttcgaaagggggcataaaatcatcatcagttctagcagg
agaatccagaaaggggaagagctctgttacgactataagtttgattttgaagatgatcag
cacaagattccatgtcactgtggagccgtgaactgccggaaatggatgaactag

DBGET integrated database retrieval system