KEGG   Anolis carolinensis (green anole): 100556163
Entry
100556163         CDS       T01608                                 

Gene name
rela
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04137  Mitophagy - animal
acs04210  Apoptosis
acs04218  Cellular senescence
acs04620  Toll-like receptor signaling pathway
acs04621  NOD-like receptor signaling pathway
acs04622  RIG-I-like receptor signaling pathway
acs04623  Cytosolic DNA-sensing pathway
acs04625  C-type lectin receptor signaling pathway
acs04920  Adipocytokine signaling pathway
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100556163 (rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100556163 (rela)
  09143 Cell growth and death
   04210 Apoptosis
    100556163 (rela)
   04218 Cellular senescence
    100556163 (rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100556163 (rela)
   04621 NOD-like receptor signaling pathway
    100556163 (rela)
   04622 RIG-I-like receptor signaling pathway
    100556163 (rela)
   04623 Cytosolic DNA-sensing pathway
    100556163 (rela)
   04625 C-type lectin receptor signaling pathway
    100556163 (rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100556163 (rela)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100556163 (rela)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100556163 (rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acs03000]
    100556163 (rela)
Transcription factors [BR:acs03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100556163 (rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100556163
NCBI-ProteinID: XP_008123768
Ensembl: ENSACAG00000004399
LinkDB
Position
Un
AA seq 533 aa
MADPLAHIQAGFGSAAMDDLLPLIFQQNWDPAPSSTPFVEIMEQPKQRGMRFRYQCEGRL
AGSIPGERSTETTKTHPTIKIHNYVGPGKVRISLVTKETPYRPHPHDLVGKDCKEGYYEA
ELSPERSIHSFQNLGIQCVRKRDLDKAVAKRIETGNNPFNVSVEELKGDYDLNAVRLCFQ
VWIRDAGSGHLVQLPLVVSQPIYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQK
EDIEVRFFKDSWEAKGSFSQADVHRQVAIVFKTPPYLDQALREPVTIQMQLRRPSDKEVS
GPMEFRYLPDEGDSHRIEEKRKRTLSTFKTFVQKAPFAAPEPRSWRRIAVPKQNLARPGT
SGIPGMMGAAGPAPLLAQKSQSLAQPPPGYFAGPGHAPPAPAPAAAQANFSTVNLEDLSG
LGVAQPVQPPAAEAESSIADAFLHLHFEGGDAGAMELGGILDDVPYASLEGINTAEFRQL
LTEGPAPAAATALPDGQGTLLTYPESITRLVSQRRAEGEPGGGGDAGGGGGGG
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggcggacccgctcgcccacatccaggccgggttcggaagcgcagccatggacgacctc
ctgccattgatttttcaacagaactgggaccccgctcccagcagcacccccttcgtggag
atcatggagcagcccaagcagcgcggcatgcgcttccgctaccagtgcgaggggcgcctg
gcgggctccatcccgggagagcggagcaccgagaccaccaagacccaccccaccatcaag
atccataactacgtgggtccagggaaagtccgcatctcgcttgtgaccaaagagacgccg
taccggccccatccgcacgacttggtgggaaaagactgcaaagagggctactacgaggcc
gagctctccccagaacgctccatccacagcttccagaacctggggatccagtgcgtgcgg
aaacgagacctggacaaagcggtggccaagcggatcgaaaccggcaacaatccgttcaat
gtgtctgtcgaggagctcaaaggagactatgacctgaatgcggtccggctctgcttccag
gtctggatccgggacgcgggcagcgggcacttggtccagctgcctctggtcgtctcgcag
cccatctacgacaaccgtgctcccaacaccgcggagctgaagatctgccgggtgaaccgt
aattcggggagctgccgggggggagacgagatcttcctcctttgtgacaaagtgcagaaa
gaggacattgaggtccgcttcttcaaggactcctgggaggccaagggctccttctcccag
gcggacgtccaccgccaagtggccatcgtcttcaagaccccgccctacctggaccaagcc
ctgcgggagcccgtcaccatccagatgcagctgcggcgcccctccgacaaggaggtcagc
ggccccatggagttccggtacctgcccgatgaaggcgactcccatcggattgaggagaag
cgtaaacggacgctcagcaccttcaagacctttgtgcagaaggctccctttgcagctcct
gaacctcgctcctggcgccgcatcgctgttccaaaacagaacttggcccggcccggaacc
agcggcatcccggggatgatgggcgcagcaggaccggccccgctgctggcccagaagtcg
cagagcctggcgcagccccctccgggctacttcgcggggcccggccacgccccgccggct
cccgccccggccgctgcgcaggcgaacttcagcacggtgaacctggaggacctctctggc
ctgggcgtggcccagccggtgcagccgcccgcggcggaggccgagagcagcatcgcggac
gccttcctgcacctgcacttcgagggcggggacgcgggggccatggagctgggcgggatc
ctggacgacgtgccctacgccagcctggagggcatcaacacggccgagttccggcagctc
ctgaccgagggcccggcccccgcggcggccacggcgctccccgacggccagggcaccctc
ctcacctacccggagtccatcacccgcctggtcagccagcgcagggccgagggggagccc
gggggcggcggggacgccggaggaggaggaggagggggc

DBGET integrated database retrieval system