KEGG   Anolis carolinensis (green anole): 100556317
Entry
100556317         CDS       T01608                                 

Gene name
braf
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04150  mTOR signaling pathway
acs04270  Vascular smooth muscle contraction
acs04510  Focal adhesion
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100556317 (braf)
   04012 ErbB signaling pathway
    100556317 (braf)
   04068 FoxO signaling pathway
    100556317 (braf)
   04150 mTOR signaling pathway
    100556317 (braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100556317 (braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100556317 (braf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100556317 (braf)
   04914 Progesterone-mediated oocyte maturation
    100556317 (braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100556317 (braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100556317 (braf)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100556317 (braf)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100556317 (braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 APH Kdo
Other DBs
NCBI-GeneID: 100556317
NCBI-ProteinID: XP_003220899
LinkDB
Position
5
AA seq 905 aa
MSGCFPLTSPRACAAILSDVTAGGVTCCRRPRLVAWVLLLSRPPPVFPSVAPPPSPTTGR
GWGRPGRQGRRGSLSPPPSLSSGSSPSSPSSAARSKMAAVSSDGDAEGASLFNGDMEPEL
PPLPSTPGAFPGAGSAAGGDPAVPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLE
AYEEYTSKLDALQQREQQLLESMGNGTDFSVSSSASTETVASSSSSSLSVAPSSLSVYQN
PTDLSRNNPKSPQKPTVRVFLPNKQRTVVPARCGVTVRESLKKALMMRGLIPECCAVYRI
QDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFR
CQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHRPISQEETSLGESTTACGSYSSV
VPSDLSGSTVLPSPSPSKSIPIPQPFRQGDEDHRNQFGQRDRSSSAPNVHINTIEPVNID
DLIRDQGLRGEGAPMNQLMRCLRKYQSRTPSPLLHSVPSEIVFDFEPGPVFRGSTTGLSA
TPPASLPGSLTKALQKSPGPQRERKSSSSSDDRTRMKTLGRRDSSDDWEIPDGQITVGQR
IGSGSFGTVFKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTK
PQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDVARQTAQGMDYLHAKSIIHRDLKSNNI
FLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAF
GIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRD
ERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGE
FAAFK
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgtcagggtgtttcccgctgacgtcccctcgcgcatgcgcggcgatcctgagtgacgtc
acggccgggggcgtgacgtgctgcaggcggccgcggctggtggcctgggtccttctcctc
agccgccctcctcctgttttcccctcggtggccccgcccccctctccaactacgggtcgc
ggttgggggcggccgggtcgtcaagggcgacgcggctccctctcgccgcccccctccctc
tcctccggctcttccccctcctccccctcctcagccgcgcgctccaagatggcggcggtg
agcagcgacggagacgccgagggggcctcgctcttcaacggggacatggagcccgagctg
ccgcctctgccgtcgacgccgggggccttcccaggagcgggaagcgccgcaggaggagac
cccgccgtgccggaggaggtgtggaacatcaaacagatgattaaattaacacaggaacac
atagaagccctactggataagtttggaggagaacacaatccaccatccatttatttggag
gcctatgaagaatacaccagcaaactagatgcactacagcagagggaacagcagttattg
gaatccatggggaatggaactgatttctctgtctccagttctgcttcaacagaaactgtt
gcatcatcatcatcatctagtctctctgtagcaccttcatctctctcagtttatcagaac
cctacagatttgtcaaggaataatcctaaatctccacagaagcctactgttagagtcttc
ctacccaacaaacagaggacagtggttccagcaagatgtggggtaacggtccgggagagt
ttaaagaaagcactgatgatgagaggcctaattccagagtgctgtgctgtttaccgaata
caggatggggagaagaaaccaattggatgggacacagacatttcctggctgacaggagaa
gaactacatgtggaagttttggagaatgtgcctcttacaacacacaactttgtgagaaaa
accttcttcactttagcattctgtgacttctgtcgaaagctgcttttccagggattccgt
tgtcagacttgtggatataaatttcaccagcgttgtagtacggaggttccactgatgtgt
gtgaattatgatcagcttgatttgctgtttgtctccaagttctttgaacaccgtccaata
tcacaggaggagacctccctaggagagtcgaccacagcatgtggatcatattcttcagtg
gtcccctcagatttgtctgggtcaacagttctccctagtccttctccttcaaaatccatt
ccaataccccagcctttccgacaaggagatgaagaccatcggaatcagtttggtcaacga
gaccgatcttcatctgcacccaatgtgcacatcaatacaatagaaccggtcaacattgat
gacttgattagagatcaagggttgcgaggagagggagcccctatgaaccagctgatgcgc
tgccttcggaaataccaatcccggactcccagtcccctcctccattctgtccccagtgag
atagtgtttgattttgagcctggcccagtgttcagaggctcaaccactggattgtctgct
acaccacctgcatctttacctggctccctcaccaaagcattacagaaatcccctgggcct
cagagagagaggaagtcctcctcatcgtcagacgatcggaccagaatgaaaacgcttggt
cggcgagactcaagtgatgactgggagataccagatggccagatcacagttggacaaagg
ataggatctggatcatttgggacagtctttaagggaaaatggcatggtgatgttgctgtg
aagatgttgaatgttacagcccctacccctcagcagctgcaggcctttaaaaatgaagta
ggtgtactcaggaaaacacgacatgttaatatattacttttcatgggttattcaacaaag
ccgcagctagctatagttacacaatggtgtgaaggctcaagtctttaccaccatctacac
ataatagaaacgaaatttgagatgatcaagctgatagatgttgcacggcagacggcacaa
ggaatggattacttgcatgccaagtccatcatccatcgagacctcaagagtaataatata
tttcttcatgaagacctcacagtaaaaataggtgactttggtctggcaacagtgaaatca
cgatggagcgggtcccatcaatttgaacagttgtctggatcaattctctggatggcacca
gaagtaattaggatgcaagataaaaacccttacagcttccagtcagatgtctatgcattt
gggattgttctttacgagctgatgactgggcagttaccatattctaacatcaacaataga
gaccagataatttttatggttggacgaggctacctctctccagatctcagcaaagtaaga
agtaattgtcccaaagcaatgaaaaggctaatggcagaatgcttgaaaaagaagagggat
gaacgacccctcttcccacagattcttgcttctattgagctcctggcccgatcgttgcca
aaaattcaccgcagtgcatctgagccctcattgaaccgggctggtttccagacagaggat
tttagcctatatgcttgcgcttctccaaaaacacccatccaggcagggggatacggcgaa
tttgcagcgttcaagtag

DBGET integrated database retrieval system