KEGG   Anolis carolinensis (green anole): 100556318
Entry
100556318         CDS       T01608                                 

Gene name
apaf1
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100556318 (apaf1)
   04115 p53 signaling pathway
    100556318 (apaf1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100556318 (apaf1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD WD40_like CARD_2 eIF2A AAA_16 NACHT AAA_22
Other DBs
NCBI-GeneID: 100556318
NCBI-ProteinID: XP_003221150
Ensembl: ENSACAG00000013012
UniProt: G1KNE2
LinkDB
Position
5
AA seq 1253 aa
MDLTARSHLLQNREALERDIKTSYVIDHMIADGALTPQEEAEVKAVTTQRDRAAKLIKTI
LKKDDHAYISFYNALVHEGYKDLAALLQDGIPIISPRNGNKSTDGVTSYVKTILCEGGVP
QRPVVFATRPELTKRIQRKLYKLKSDPGWVVIYGMAGCGKTVLAADALRDHNLLKDCFPG
GVHWVSIGKQDKSGLLIKLQNLCLRLDQDVTYLQRPPLNIEEAKDRLRVLLFRKYPRSLL
VLDDIWDSWVLKAFDSHFQILLTSRDRSVTDSVTGKKYEVPVESGLSHEKALEILSLFVN
MEITELPEKADWIVKECKGSPLVVSLIGALLRDFPNRWEYYLRQLQNKQFRRIKKSSSYD
YEALDEAMSISVEMLPENSKDYYRDLSVLQKDVKVPSKVFCVLWDIETEEAEDILQGFVN
KSLLFCDRNGKSFHYYLHDLQLDFLTEKNRDQLQALHKKVVHQYKNHYAQYMPNSTQEDW
MYWYNFLAYHMSSASMHDELCALMFSLEWIKTKTELVGPAHLIHEYVEYSEILNEKDPIA
RENFQEFLSLNGHLLGRQPSLDIVQLGLCQPESSKVYQQAKLQAQQGLDKGSFYVEWMNK
QSIKNTYRLVVRPHTDAVYHACFSQDRHRIASCGADKTLQIFKAESGEKLLEVKAHDDEV
LCCSFSADDRFVATCSADKKVKVWNSRTGQPVCIFEEHTEQVNCCQFSNTNHNQFLLATC
SNDSFIKLWDLNKKYCRNTLFDHSSSVTHCRFSPNDKYIASCSADGTLMLWYAQSANKRK
TVDIRGNFRNVDEYQDDMEVLVKCCSWSSDSTTIVVAAKNKLFRTDTKISTSLPEVLINH
HYTIQYCDFCPNSQMVAVALSNYSVEIWNIESCSKIADCRGHMSWVHSVTFSFDGSLFLT
SSDDQTIRIWETSKVCNFSAIVLNREIDVLFLDSDVIILAIDSSKRLQLISGYTGNTIYL
TKEQDSLICCCCLSHDRKVAAFGENNGTVKVLSLQNGNTLNSRTGHREAVQHCQFTSDGK
TLISSSDDSTIQVWNWQSEECILLKGHNERVKKFLLLKDSRLLSWSFDGTVKLWNIVTGE
IEKDVICHENAILSCAISPDATMFSTTSSDKTAKIWSFETSSMLHKLNSHESCVRCCAFS
LNNELLATGDDNREIRVWDVSRGELLHLCSRASIDEGESAHEGWVTDLCFSPDNKILVSS
AGYIKWWNVDTGQPLQTFYTNGTDLKSLHVSPDFKVCVTVDNLGILYVLRIME
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggatttgaccgctcgaagtcacttgcttcagaatcgggaggctctggaaagagatatt
aagacttcctatgtaatagaccatatgattgcagatggagcgttaacaccgcaggaagag
gcggaagtaaaagctgtgactactcaaagggatcgagcagctaagcttataaaaacaatt
cttaagaaagatgaccatgcatacatatcattttataatgctctggttcatgagggatac
aaagatcttgctgcccttctccaagatggtatcccaattatttcccctcgtaatggaaat
aagtctacagatggagtaacgtcctatgttaagaccatcctttgtgaaggtggagttcca
cagcggccagttgtatttgccactcgtccagaactcacaaaaagaatacagcgaaaacta
tataagctgaaaagtgatccaggatgggttgttatttatggtatggcaggctgtggaaag
actgttttggcagcagatgcacttcgtgaccacaatcttttgaaagactgcttcccagga
ggagtacattgggtttctattgggaaacaagacaagtcaggcctgttgataaaactccaa
aatctgtgtctgaggttggaccaggatgtcacttatttacagaggccaccacttaatatt
gaggaagcaaaagatcgccttcgagtgttgctgtttcgcaaatatccaaggtctctgttg
gttctggatgacatttgggattcatgggtattaaaagcctttgatagtcatttccagatt
cttctcaccagtagggacaggagtgtaacagattctgtaacaggcaagaaatacgaagtt
ccagtggaaagtggactatcacatgaaaaagcacttgaaatattatccctatttgttaat
atggaaataacagagctaccagaaaaagctgattggattgtaaaagaatgcaaaggttct
cctcttgtggtatctttaataggagcattattacgagattttccaaatcgctgggaatac
tatcttagacaacttcaaaataagcagttcagaagaataaagaaatcttcatcttatgat
tacgaagcacttgatgaagcaatgtccataagtgttgaaatgttgccagaaaattctaaa
gattattacagagatctttctgtccttcaaaaggacgttaaagtgccttcaaaggtattc
tgtgttctttgggatattgagactgaagaagctgaagatatactacaaggatttgttaat
aaatctctcctgttctgtgatcgaaatgggaaatcattccattattatttgcatgatctt
caacttgattttcttactgagaagaatcgtgatcagttgcaagcactacataaaaaagta
gttcatcaatacaagaaccactatgcacagtatatgccaaattcaactcaggaagactgg
atgtattggtataattttctcgcgtaccatatgtcaagtgctagcatgcatgatgaactc
tgtgctctcatgttttcactagaatggattaaaactaaaacagaattggtaggacctgca
catttgattcatgaatatgttgaatacagtgaaatattgaatgaaaaggatcccattgca
cgtgaaaacttccaggaatttttatctttaaatggacacctgcttggacgacagccatct
ctggacattgtgcagctgggcctttgtcaaccagagagttcaaaagtatatcaacaagcc
aagctacaagctcagcaaggacttgataaaggatccttttatgtggaatggatgaataag
cagtccataaagaatacttatcgtctggttgtgcgtccacacacagatgctgtttatcat
gcttgtttttcccaggacagacacagaatagcttcatgtggagctgataaaacattgcag
atatttaaagcagaaagtggagaaaagcttctggaagtaaaagctcatgatgatgaagta
ctgtgttgttccttttcagcagatgacagatttgttgctacttgttctgctgacaaaaaa
gtaaaagtctggaattcacgaacaggtcaacctgtgtgcatatttgaagaacatacagag
caggtcaactgctgtcagtttagcaatacaaatcataaccagtttctgttagctacttgt
tcaaatgacagttttatcaaactctgggatttgaataaaaagtactgtcgcaatacgcta
tttgaccacagcagttctgttactcactgcaggttctctccaaatgataaatacattgct
agttgttcagcagatggaactttaatgctttggtatgcccagtcagcaaataaacgaaaa
actgttgacataagaggcaacttcaggaatgtggatgaataccaagatgacatggaagtg
ttagtgaaatgttgttcatggtcatctgatagtactacaatagtcgtagcagccaaaaac
aagctttttcgtactgataccaagatcagtacttcattgccagaagtccttataaaccac
cactatactattcagtattgtgatttttgtccaaatagtcagatggtggcggttgcttta
tcaaattattctgttgagatatggaatattgaatcctgttccaaaatagcggactgtcgt
ggacatatgagctgggtgcattctgtgacattttcttttgatggttctttattcctcact
tcttctgatgaccaaacaataaggatttgggagacaagtaaggtatgcaacttctctgct
attgtgttaaaccgtgaaatagacgttctgtttctggacagtgacgtgatcatcttagcc
attgatagttcaaagcgtctgcaacttattagtggatacacaggcaataccatttatttg
accaaagaacaagattctttaatttgctgttgctgcttgagccatgaccggaaggttgca
gcatttggagaaaataatggaacagtaaaggtcttaagtctgcaaaatggaaatacttta
aattctagaactggacacagagaagctgtacaacactgccagtttacttctgatgggaaa
acacttatttcaagctctgatgactcgactatacaggtatggaattggcagtcagaggaa
tgcattcttctaaaaggtcacaatgaacgtgtcaagaaatttcttcttctaaaagattca
aggcttctgtcatggtcatttgatgggacagttaagctttggaacatagttactggagaa
atagaaaaagatgtcatctgccatgaaaacgctattctttcttgtgcaatttcacctgat
gccactatgttttctactacctcttctgacaagactgccaagatatggagttttgaaaca
tcatcaatgcttcataagctaaatagtcatgaaagctgtgtaagatgctgtgctttctca
cttaataatgaactgcttgccacaggagacgacaatagagaaatacgggtgtgggatgtc
tcaagaggtgagctgctccatctctgttctcgtgcttcaatagatgaaggcgaatcagca
catgaaggctgggtaacagacctttgcttttcccctgacaataaaatcctggtttcttct
gcaggatatataaagtggtggaatgtggatactggtcaacctttacaaacattctacaca
aatggaacggatcttaaatctctgcatgtgtccccagatttcaaagtatgtgtgactgtc
gataatcttggcattctttatgtgctacggattatggaataa

DBGET integrated database retrieval system