KEGG   Anolis carolinensis (green anole): 100556408
Entry
100556408         CDS       T01608                                 

Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs03440  Homologous recombination
acs04068  FoxO signaling pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100556408
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100556408
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100556408
   04210 Apoptosis
    100556408
   04115 p53 signaling pathway
    100556408
   04218 Cellular senescence
    100556408
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100556408
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acs03032]
    100556408
   03400 DNA repair and recombination proteins [BR:acs03400]
    100556408
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100556408
Protein kinases [BR:acs01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100556408
DNA replication proteins [BR:acs03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100556408
DNA repair and recombination proteins [BR:acs03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100556408
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC PYRIN HEAT Malt_amylase_C
Other DBs
NCBI-GeneID: 100556408
NCBI-ProteinID: XP_008116369
Ensembl: ENSACAG00000002967
LinkDB
Position
Un
AA seq 3059 aa
MNLALHDLLTCCRQLDSDKATERKKEIEKFKRLLRDSEIIQQLDQNSDSKHGKQLNWDTV
FRFLQKYIHKETESARLAKPNVSASTQATRQKKMQETSSLAKNFIRCANKRAPRLKCQDL
LMYFTNTVNDPSSYAIYGADCSSILLKNILAVRKYWCEISSQQWSDLQNLYFRLFLSPSR
DINKVVVARIIYTLTRGLCFQTDGLNSNIFNFFSKAMQYARQERNPVALEYIFATMNVFF
NVFAMNYRFRVCKLGEEILPTVLRIWAQHKPNKSLKEQIIRLVQLQVHVHHPNRAKSQEA
GVCNSVAWQGILYNLYDLLSNEVTVYSNRGKYSAGSRSVAVKENLVELFADICHQLFTEG
TKVLEISQWHAVTQRESGDGEGPSKRRRIELGWEVIRDNLQRSQKDCDVVPWLQIATRLL
SKYPTSFPQHELLLLLNILYQLLPQQRRGERTLYVLRCLKEVALCQGQIIHLKSSNRLEL
QRTWSKIWSLVVRSISLQQIEVESFGLLGAMIQENTKTMDRELWKIFSGSSCKPSRSAAQ
FLTIALKTSELPEILKSGTAQNNWEGSTALTLKEEIMKWLLFCHVEEDTEDTMELPPILC
SDFPKLELQKILVSLTMKNSRSAMNFFHSASECLQHTPEKEVSLSETEAFYTQTICDEID
VFTNMTNEKLESKPSSSRLIVSQKHRQALEHDLMVMSEKLLSSFSLEGTSAEILVRCSGL
LTGVLGCYCYAGVLTAEEARKSELFHKAKSLIHCIGESISQSKNKLNEDSRTSSMKNLIM
QCASCLCNCNQNSPQNSMSDIWLHLLTSKMMNDLTDICKHLMAFTTKANEIGEVDVMEED
PEESRMEEDQAVLDLFDDDSAAAGDANENKELQNLAGAVSPLSEEHLTKQDLLLLDILKF
LCIAVTATSGQIVCFRVSEIRRKLLMLIEGNTFDYTKPLHLHMYLILLKELPSEENPLLE
DQIVSLLSPLTDVCSFYRRDQEVCSAILHNLLPMVTALGIATTNTEDLSRAQGSFLTVIG
AFWHLASERKYTAPVRIALVNCMKALLQVDPYSKWTMLNVKHQNLTVHDAFSNFLADSNF
QVCMVAAKSVTSLFQDEKQRDSIGLLKPLKPLPLKIQQRAFDNLYIKVQDGTKKLATGTV
CQENLPDEERNRKLVLLTLLTMILRCSPVCEKKALFAIFQCVKENGLEPQLVRKVLERIS
GTSGYKNAEDFMNTHLDYLVQEWLNCGYSLSLFPYALLNYSDLEEFYRSCYKMLIPQLVI
RNQFEEVKCIADKIKREGKQLLAHCFPKILVNILPYFAYQNHEDDEFAEKRQRASKVYET
LKSECCLGRQLIENLFHSNLPEIVVEILMTLHEPVDIKAGEECDLKRFAGDLDPSPNPPY
FPSYVIKTTLDYISNCCKTKSKELVAVLSKNPESFQKILFDICRQASETNNIYKKHRILM
VYHFFVNLLLKEIKDGLGGAWAFVLRDVIYTMIHHINKRSIPLRGIFLRNFLLCLDLLNH
ICHITVKYCRDALGTHLHVIVGTLVPIVEEQPEAQEEILSLLRYLVIDNKDNENLYQAMK
HLDPFPDHPAFKELRAVQQQIKYSKGEFSLLEEINHFLSINISDSLSLTRREGLSDLRKR
LEKHKEQMKSLMKEFQENPKDCVIVKLVVCLLQLSKTAINSSDTILEAVGSCLGEIGPIS
FSTTALQHNKNMSCLSAADLFEDRELQWVFIMLTLINNALIDQCIEVRSAAASCLKNILA
TKTGHEFWEIYKAEDDPMLVYLHPFRTSKKKVLEVSHKTQGTLSEDLDSANLWIPQSENH
AVWIKTLTCALLDSEGVKSETLLLLKPLCEVQTDFCQTVLPYLIHDILLHDSNEFGQTLL
STHIQTFFSTCCKYAFPSSRTSTPACSDPDSEPLANGSLDKISRRTMLAIVDYLRRQKKN
PSSTVFDDSFWLDLNYLQVAMAAQSCAAHFTALLYAEIYADKINQDKQQERSASKPARCL
AFEEESQNETLTCLSNKSKEDTGISLQDLLMEIYRSIGEPDSIYGCGGGRMLQPLARIRT
YEHEAVWGKALVTYDIETGLPPSTRQAGIMEALQNFGLYDTLSIYLKGLEQENEESTMEL
QELRYQAAWRNMQWDHISSVKDEMGGRGYHESLYDTLQCLKDKEFSTFHDRLKCARVKEV
EELSKGSLESVYSLLPALCRLQTIGELECIGQLFTGSVSNSELNNIYLKWQRQSRLLQDS
DFSFQEPIMALRTVILNILLEKEMDNTKRECIKDILTRHLVELSRLGRMANNTQLPERAI
FQIKQYNPTRHRISEWQLEEAQVFWAKKEQSLALNILKEMIKKLDDDWTKVEKDANLRLI
YTECLRLCGSWLAETCLENPTVIMRNYLEKAIEVAGSQKGDSSDEQKSGKMKAFLSLARF
SDTQYQRIENYMKSSEFENKQALLRKAKEEVGLLREHKVQTNRYTVKVQRELELDECAIR
ALAEDRKRFLCKAIENYINCLLSGEEHDMWIFRLCSLWLENSGISEVNGMIQKEAKKIPS
YKFLPLMYQLAARMGTKIGFHQVLNNLIARISLDHPHHTLFIILALANANKDELLTKQEA
ARRSGLTKNTPKETSLLDMDRIKAASSIINIVKHRRTDMVAKVETLCDAYITLANMDASC
WKSQKGGINIPSDQPITKLKDLEDVVVPTIEIKVDPSGKYENLVTIRSFKTQFHLAGGLN
LPKIIDCVGSDGIERRQLVKGRDDLRQDAVMQQVFQMCNTLLQENTETRKRKLTIRRYKV
VPLSQRSGVLEWCSGTIPLGDFLVNTDRSAHKRYRPKDYSNLDCQSKMVQAQKKSFEEKY
AIFIDVCQKFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNIL
LDEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMAV
MRNSQEALLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDEADVGSSLNAADQSCSKKANG
DNQTFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9180 nt   +upstreamnt  +downstreamnt
atgaatcttgcactccatgacctgttgacttgctgccgtcaacttgacagtgacaaggcc
acagaacgaaagaaggaaattgaaaagttcaaacgtcttctccgtgactctgaaataatt
cagcagttggaccagaactctgattccaaacatggaaagcagcttaactgggatactgta
ttcagatttttgcagaagtacattcacaaagaaactgaaagtgccaggcttgcaaagcca
aatgtgtctgcatcaacacaagcaacaagacaaaaaaagatgcaggaaaccagcagtctg
gccaaaaatttcatcagatgtgccaataaaagagcacccaggttaaagtgtcaggacctt
ttgatgtatttcacgaacacagtaaatgatccatcaagttatgctatttatggagcagac
tgtagtagcatattgctaaaaaatattcttgcggtgaggaaatactggtgtgaaatatct
tcgcaacagtggtcagatctccagaatttgtacttcagattgttcctcagcccatccaga
gacattaacaaggttgtggtggctagaataatttacacactcaccagaggattgtgcttc
caaactgatgggctaaattctaatatttttaacttcttttcaaaagctatgcaatacgca
agacaagaaagaaaccctgtggctcttgaatatatttttgctaccatgaatgtatttttc
aatgtgtttgccatgaattaccgtttccgagtttgtaagctgggagaggagattctgcct
actgtgcttcgtatatgggctcagcataaaccaaacaagtccctgaaggagcaaatcatt
cgattagttcagcttcaagtccatgttcatcatccaaatagagctaaaagccaagaagca
ggagtctgtaactcggtggcatggcaaggcattttatataacctctatgatctgttatct
aatgaggtgactgtctatagcaacagaggaaaatattctgcaggctcgcgcagtgttgct
gtgaaagaaaaccttgttgagttatttgctgatatttgtcatcagctctttacagaaggc
acaaaagttttggagataagtcagtggcatgctgttacacagagagagagtggagatgga
gaagggccatccaaacgaaggagaattgaattgggttgggaagtgattcgtgacaacctg
caaagatcacagaaggactgtgatgttgttccctggctgcagattgcaaccagattatta
tcgaagtatccgacaagctttcctcagcatgagttgcttctcctactcaacatactttac
cagctactgcctcagcagcgtcgaggggaaaggacactttatgtcttaagatgtctcaaa
gaggttgcactttgtcaaggccaaataatacatctgaaaagcagtaatagattagagctg
cagagaacatggtcaaaaatttggtctcttgtggttcgtagcataagtcttcagcaaatt
gaagtagaaagttttggattacttggagccatgattcaagaaaacacaaaaacaatggac
agagaattgtggaagatattttcgggatcttcatgcaagccttcaagatctgcagcacag
ttcctgacaatagcacttaaaacttcagaactgccagaaattttgaaaagtgggacagca
cagaataattgggaaggaagtacggctcttacattaaaagaagaaattatgaagtggctt
ctgttctgccatgtggaggaagatacagaggatactatggagctgcctcctattctatgc
agtgactttcctaaattagagttgcagaaaatccttgtaagcctcactatgaaaaatagt
cgctcagccatgaatttttttcacagtgcttctgaatgtttgcagcatacaccagaaaaa
gaagtcagtctttcagaaacagaagcattctacacacaaacaatttgtgatgaaattgat
gtatttacaaacatgacaaacgagaaattggaaagcaaaccctctagttccagactgatt
gtcagccagaaacatcggcaggccttagagcatgatctcatggtgatgtcagaaaaactt
cttagtagcttttcgcttgagggtacgtctgcagaaatcctggtacgttgtagtggcctc
ttgactggagttcttggctgctattgctatgctggtgtcctcacagcagaagaagcacgt
aaatcagagctttttcacaaagccaagtctcttattcattgcataggagaaagcatttct
cagtctaaaaacaaactaaatgaagattccagaaccagttcaatgaagaatttgataatg
cagtgtgctagttgtttatgtaattgtaatcagaacagcccccaaaatagtatgtcggac
atttggttgcatttgttaacatcaaagatgatgaatgatcttacagatatttgcaaacat
ctgatggcttttaccacaaaagcaaatgaaattggagaagtggacgtaatggaagaagat
cctgaagagagtagaatggaagaagaccaagcagtcttggatctgtttgatgatgactct
gctgcagctggtgatgcaaatgagaacaaagaattgcagaacttggctggtgctgtaagc
ccattatcagaagaacatctgactaagcaggacttgctgctccttgacattttaaagttc
ttatgtattgctgtcacagcaacttcaggacaaatagtttgctttagagtttctgaaatt
cgaaggaaactcttaatgctaatagagggaaatacatttgattatacaaaaccacttcat
ctccatatgtacttgattttgttgaaggaactcccaagtgaagaaaatcccttactagag
gatcagattgtatcacttctcagtcctcttacggatgtctgttccttttatcgtcgagat
caagaggtttgctcagcaattctccacaatcttcttcccatggtgactgccttgggcatt
gccacgacaaatactgaagatttaagtagagcccaaggttcatttttaactgttataggg
gcattctggcatttagcaagtgaaagaaaatatactgctccagtaagaatagccttagtg
aattgtatgaaagccttacttcaggttgatccgtattcaaaatggaccatgctcaatgtt
aaacatcaaaatctgacagtgcatgatgctttctctaacttccttgctgacagcaacttt
caagtttgcatggttgctgcaaaatcagtaaccagtttgttccaagatgaaaaacagaga
gattctattggtttactgaaacctctgaaacctcttcctctgaagatccagcaaagggca
tttgacaatttgtacataaaagttcaagatggaacaaagaaactggcaactggcactgtg
tgtcaagagaatcttcctgatgaagaacgtaatagaaaattagttctccttacattgcta
acaatgattttacgctgcagtcctgtgtgtgaaaaaaaagcattgtttgcaattttccag
tgtgtcaaagagaatggattagagcctcagcttgtaagaaaggttttagaaagaatttct
ggcacttctggctataaaaatgcagaggattttatgaatacccacttagattatcttgtt
caagaatggttgaactgcggctatagcctttcacttttcccttatgctttattgaattac
tctgatttagaggaattctacagatcctgctacaaaatgttgattccgcaactggtaatc
agaaatcagtttgaagaggtcaaatgcattgctgacaagatcaaaagagaagggaagcag
cttctggcacactgctttcccaagatccttgtgaatattctcccttactttgcctaccag
aatcatgaagatgatgaatttgcagaaaagagacagagagcttctaaagtctatgaaaca
ctgaaaagtgaatgctgcttaggaagacagctgatagaaaatctatttcatagcaatctg
ccagagattgtggtagagatattgatgaccctgcatgaaccagttgatatcaaggcaggg
gaagaatgtgatttaaagagatttgctggagatctggatccttctccaaatcctccttat
ttcccatcatacgtcatcaaaacaacattggattacattagcaattgctgtaaaacaaag
tcaaaagaacttgtagcagttctttccaaaaaccctgagtcattccagaagatcttattt
gacatatgtaggcaagcatctgaaacaaataatatttacaaaaaacataggattcttatg
gtgtatcacttttttgtaaatttgttactgaaagaaataaaagatggtcttggaggcgca
tgggcttttgtgcttcgggatgtaatttatactatgattcatcacatcaataagagatca
ataccactcagagggatattccttcggaattttttgctatgtttagatcttctcaatcac
atttgccacataacagttaaatattgtcgcgatgccctagggactcacctccatgttatt
gtgggtacacttgtgcctattgtggaagagcaacctgaagcccaagaagagatcttgagc
ttactgagatatctggtaatagataataaggacaatgaaaatctgtaccaggcaatgaaa
catctagatccttttcctgaccatcctgctttcaaagaactgcgagctgttcagcaacaa
ataaaatacagcaaaggggaattttctcttttggaggaaataaaccacttcctttctata
aatatctctgattcattatcattaaccagacgggaaggtttaagtgatttgcgcaaacga
ctggaaaagcataaggaacaaatgaaaagccttatgaaagagtttcaggaaaatccaaag
gactgtgtaatagtgaagcttgtggtatgtcttttacaactttcaaaaacagctataaac
tcttcagatacaatcttggaggcagttgggagttgtttgggagaaattggccccatcagt
ttttctaccacagctttacaacacaataaaaacatgtcctgcttaagtgcagccgatctc
tttgaagacagggaacttcagtgggtcttcatcatgttaactctcataaataatgcttta
atagatcagtgcattgaagttagatctgctgctgcttcttgtttgaaaaacattttagcc
accaaaactggtcatgaattctgggagatttacaaagccgaagacgatcccatgctggtt
tacctccatcctttcagaacgtctaagaaaaaggtattggaagtatctcataaaacacaa
ggtactctttcagaagatctggacagtgcaaatctctggattcctcagagtgaaaaccat
gctgtttggattaagactttgacttgtgcacttttggatagtgaaggtgtaaaaagtgaa
actcttctgttgttgaaacccttgtgtgaggttcaaacagatttttgtcagactgtactt
ccataccttattcatgacatcctgttacatgactcaaatgaatttgggcagactcttttg
tccacacatattcagacatttttcagcacttgttgcaaatacgcatttccctccagtagg
acatcgacgcctgcatgttcggatccagattcagaaccgcttgctaatggcagtttggat
aaaatatctcgaagaacaatgcttgctatagttgactacttaagacgacaaaagaaaaat
ccttcaagtaccgtctttgatgacagcttttggctggatttaaattaccttcaggttgcc
atggcagcccagtcttgtgctgctcatttcacagctttactgtatgcagaaatctatgct
gacaagataaaccaggacaagcagcaagaacggtctgcttccaaaccagctagatgtcta
gcatttgaagaagaaagtcaaaacgaaactcttacttgtttgagcaacaagagtaaagaa
gacactggaataagtttgcaggatcttctcatggagatttacagaagcataggagaaccg
gacagtatctatggctgtggtggagggagaatgttgcagccattagctagaataagaaca
tatgaacatgaagcagtgtgggggaaagccctggtgacttacgatattgaaacaggcctt
ccaccatcaactcgacaggcaggaataatggaggccttgcaaaattttggactatatgat
acactctcaatctatttaaaaggactggaacaggaaaatgaagaaagtactatggaatta
caagaactacgttatcaggcagcatggagaaatatgcagtgggatcacatttcttcagtc
aaagatgaaatgggaggacgaggctatcacgaatcactgtatgatactctgcagtgttta
aaggacaaggaattctctacatttcatgacagattgaagtgtgctagagtgaaggaagta
gaagagctgtctaaaggtagccttgagtctgtatattcattgctgcctgcactctgtaga
ctgcagaccattggagagttggaatgcataggacaacttttcaccggatcagtttctaac
agtgaactgaataacatatatctgaagtggcagaggcagtcccggcttcttcaggacagt
gactttagtttccaagaaccaatcatggctttgcgcacagtaattttgaacatccttctg
gagaaggaaatggacaatacgaaaagggaatgtattaaggacatcctcaccagacatctt
gtggagttgtccagattgggtcgaatggcaaacaacacacaacttccagaaagagcaata
tttcaaatcaagcagtataacccaacgagacacaggatatctgaatggcaactagaagaa
gctcaggtgttctgggctaaaaaggagcaaagcttagcactaaatattctaaaggagatg
attaaaaaattggatgacgattggactaaggttgaaaaagatgcaaacttgagactgatt
tacactgagtgtctcaggctatgtggaagctggttggcagagacttgcttagaaaatcct
acagttattatgagaaattacttggaaaaggctatagaagttgcagggagccaaaagggt
gacagcagtgatgagcagaagagtgggaaaatgaaggcttttctatctctggctcgtttt
tcggacactcagtatcaaagaattgaaaattatatgaaatcatcagagtttgaaaacaag
caagctttactgaggaaagccaaagaggaagttggtcttctaagagaacataaggtgcaa
acaaacagatatacagtcaaagttcaacgggagttggagcttgatgaatgtgcaatccgt
gcgctggcagaagatcgtaaacgtttcttgtgcaaagctattgagaactacataaactgt
ttgctgagtggagaagagcatgacatgtggattttcagactctgttccctgtggcttgag
aactctgggatttctgaagtcaatggcatgattcaaaaggaggcaaagaaaataccatcc
tacaaattcctgcctctgatgtatcaactagctgctcgaatgggaaccaagattggattt
catcaagttttgaataatcttatagctcgaatctctctagaccatccacatcacactttg
tttataatcttggcattggcaaatgccaacaaagatgaactcctgacaaagcaagaagca
gctagaagaagtggtctaacaaaaaacacacccaaagaaacttccctgcttgacatggat
cgaataaaggctgctagcagtattattaacattgtgaaacacagaagaactgatatggtg
gcaaaagttgaaaccctttgtgatgcttatatcactttagcaaacatggatgcaagttgc
tggaaatcacaaaaaggaggtataaatatcccttctgatcaacctattacaaaattaaaa
gatctcgaagatgttgttgtacctaccattgaaattaaggtggatccaagtggaaaatat
gaaaatttggttacaataaggtccttcaagacgcaatttcatttggccggtggtcttaat
ctaccaaaaataatagattgtgtgggatcagatgggattgagaggaggcagcttgtcaag
ggccgtgatgacctgaggcaggatgctgttatgcagcaggttttccagatgtgcaatacc
ctgctccaggaaaacaccgaaactagaaagagaaaattgactatccgcagatacaaggtg
gtccccctctctcagagaagcggtgtcttagagtggtgttcagggacaattcccttgggt
gactttcttgtcaatactgacagaagtgctcacaagcgatacagaccaaaggactatagt
aacttagactgccaaagcaaaatggtgcaagcacaaaagaaaagttttgaagagaaatat
gccatcttcattgatgtatgccagaagtttcaacctgtatttcgctatttctgtatggag
aaatttctggatccagcagtgtggtttgagaaacgtttggcatatactcgcagtgttgcc
acttcatcaatagttggctacatacttggtcttggagacagacatgtacagaatattctg
ttagatgagcaaagtgcagagcttgttcacattgatctaggtgttgcttttgagcagggc
aaaatccttcctaccccagaaactgtgccatttaggctaacaagagatatagtagatggg
atgggaatcactggcgtagagggagtcttcaggagatgctgtgaaaaaactatggctgtt
atgcgcaactcccaagaagctttactaactattgtagaagtacttctctatgaccccctt
tttgactggaccatgaaccctttaaaagccttgtatttgcagcaaaggccagaggatgag
gccgatgttggctccagcctcaatgctgctgatcaaagttgcagcaaaaaagcaaatggt
gataaccagacatttaataaagtggcagagcgggtcttgatgcgactccaggagaaactc
aaaggagtggaggaggggaccgtgctcagtgtgggaggccaggtgaatcttctcattcag
caagctatggacccaaagaatctcagccgcctcttcccaggatggaaagcatgggtctga

KEGG   Anolis carolinensis (green anole): 100560063
Entry
100560063         CDS       T01608                                 

Gene name
atm
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs03440  Homologous recombination
acs04068  FoxO signaling pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100560063 (atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100560063 (atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100560063 (atm)
   04210 Apoptosis
    100560063 (atm)
   04115 p53 signaling pathway
    100560063 (atm)
   04218 Cellular senescence
    100560063 (atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100560063 (atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acs03032]
    100560063 (atm)
   03400 DNA repair and recombination proteins [BR:acs03400]
    100560063 (atm)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100560063 (atm)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100560063 (atm)
DNA replication proteins [BR:acs03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100560063 (atm)
DNA repair and recombination proteins [BR:acs03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100560063 (atm)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT FATC PYRIN Malt_amylase_C
Other DBs
NCBI-GeneID: 100560063
NCBI-ProteinID: XP_003221742
LinkDB
Position
5
AA seq 1153 aa
MLAIVDYLRRQKKNPSSTVFDDSFWLDLNYLQVAMAAQSCAAHFTALLYAEIYADKINQD
KQQERSASKPARCLAFEEESQNETLTCLSNKSKEDTGISLQDLLMEIYRSIGEPDSIYGC
GGGRMLQPLARIRTYEHEAVWGKALVTYDIETGLPPSTRQAGIIEALQNFGLYDTLSIYL
KGLEQENEESTMELQELRYQAAWRNMQWDHISSVKDEMGGRGYHESLYDTLQCLKDKEFS
TFHDRLKCARVKEVEELSKGSLESVYSLLPALCRLQTIGELECIGQLFTGSVSNSELNNI
YLKWQRQSRLLQDSDFSFQEPIMALRTVILNILLEKEMDNTKRECIKDILTRHLVELSRL
GRMANNTQLPERAIFQIKQYNPTRHRISEWHLEEAQVFWAKKEQSLALNILKEMIKKLDD
DWTKVEKDANLRLIYTECLRLCGSWLAETCLENPTVIMRNYLEKAIEVAGSQKGDSSDEQ
KSGKMKAFLSLARFSDTQYQRIENYMKSSEFENKQALLRKAKEEVGLLREHKVQTNRYTV
KVQRELELDECAIRALAEDRKRFLCKAIENYINCLLSGEEHDMWIFRLCSLWLENSGISE
VNGMIQKEAKKIPSYKFLPLMYQLAARMGTKIGFHQVLNNLIARISLDHPHHTLFIILAL
ANANKDELLTKQEAARRSGLTKNTPKETSLLDMDRIKAASSIINIVKHRRTDMVAKVETL
CDAYITLANMDASRWKSQKGGINIPSDQPITKLKDLEDVVVPTIEIKVDPSGKYENLVTI
RSFKTQFHLAGGLNLPKIIDCVGSDGIERRQLVKGRDDLRQDAVMQQVFQMCNTLLQENT
ETRKRKLTIRRYKVVPLSQRSGVLEWCSGTIPLGDFLVNTDRSAHKRYRPKDYSNLDCQS
KMVQAQKKSFEEKYAIFIDVCQKFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVG
YILGLGDRHVQNILLDEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGV
EGVFRRCCEKTMAVMRNSQEALLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDEADVGSS
LNAADQSCSKKANGDNQTFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPK
NLSRLFPGWKAWV
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcttgctatagttgactacttaagacgacaaaagaaaaatccttcaagtaccgtcttt
gatgacagcttttggctggatttaaattaccttcaggttgccatggcagcccagtcttgt
gctgctcatttcacagctttactgtatgcagaaatctatgctgacaagataaaccaggac
aagcagcaagaacggtctgcttccaaaccagctagatgtctagcatttgaagaagaaagt
caaaatgaaactcttacttgtttgagcaacaaaagtaaagaagacactggaataagtttg
caggatcttctcatggagatttacagaagcataggagaaccggacagtatctatggctgt
ggtggagggagaatgttgcagccattagctagaataagaacatatgaacatgaagcagtg
tgggggaaagccctggtgacttacgatattgaaacaggccttccaccatcaactcgacag
gcaggaataattgaggccttgcaaaattttggactatatgatacactctcaatctattta
aaaggactggaacaggaaaatgaagaaagtactatggaattacaagaactacgttatcag
gcagcatggagaaatatgcagtgggatcacatttcttcagtcaaagatgaaatgggagga
cgaggctatcacgaatcactgtatgatactctgcagtgtttaaaggacaaggaattctct
acatttcatgacagattgaagtgtgctagagtgaaggaagtagaagagctgtctaaaggt
agccttgagtctgtatattcattgctgcctgcactctgtagactgcagaccattggagag
ttggaatgcataggacaacttttcaccggatcagtttctaacagtgaactgaataacata
tatctgaagtggcagaggcagtcccggcttcttcaggacagtgactttagtttccaagaa
ccaatcatggctttgcgcacagtaattttgaacatccttctggagaaggaaatggacaat
acgaaaagggaatgtattaaggacatcctcaccagacatcttgtggagttgtccagattg
ggtcgaatggcaaacaacacacaacttccagaaagagcaatatttcaaatcaagcagtat
aacccaacgagacacaggatatctgaatggcacctagaagaagctcaggtgttctgggct
aaaaaggagcaaagcttagcactaaatattctaaaggagatgattaaaaaattggatgac
gattggactaaggttgaaaaagatgcaaacttgagactgatttacactgagtgtctcagg
ctatgtggaagctggttggcagagacttgcttagaaaatcctacagttattatgagaaat
tacttggaaaaggctatagaagttgcagggagccaaaagggtgacagcagtgatgagcag
aagagtgggaaaatgaaggcttttctatctctggctcgtttttcggacactcagtatcaa
agaattgaaaattatatgaaatcatcagagtttgaaaacaagcaagctttactgaggaaa
gccaaagaggaagttggtcttctaagagaacataaggtgcaaacaaacagatatacagtt
aaagttcaacgggagttggagcttgatgaatgtgcaatccgtgcgctggcagaagatcgt
aaacgtttcttgtgcaaagctattgagaactacataaactgtttgctgagtggagaagag
catgacatgtggattttcagactctgttccctgtggcttgagaactctgggatttctgaa
gtcaatggcatgattcaaaaggaggcaaagaaaataccatcctacaaattcctgcctctg
atgtatcaactagctgctcgaatgggaaccaagattggatttcatcaagttttgaataat
cttatagctcgaatctctctagaccatccacatcacactttgtttataatcttggcattg
gcaaatgccaacaaagatgaactcctgacaaagcaagaagcagctagaagaagtggtcta
acaaaaaacacacccaaagaaacttccctgcttgacatggatcgaataaaggctgctagc
agtattattaacattgtgaaacacagaagaactgatatggtggcaaaagttgaaaccctt
tgtgatgcttatatcactttagcaaacatggatgcaagtcgctggaaatcacaaaaagga
ggtataaatatcccttctgatcaacctattacaaaattaaaagatctcgaagatgttgtt
gtacctaccattgaaattaaggtggatccaagtggaaaatatgaaaatttggttacaata
aggtccttcaagacgcaatttcatttggccggtggtcttaatctaccaaaaataatagat
tgtgtgggatcagatgggattgagaggaggcagcttgtcaagggccgtgatgacctgagg
caggatgctgttatgcagcaggttttccagatgtgcaataccctgctccaggaaaacacc
gaaactagaaagagaaaattgactatccgcagatacaaggtggtccccctctctcagaga
agcggtgtcttagagtggtgttcagggacaattcccttgggtgactttcttgtcaatact
gacagaagtgctcacaagcgatacagaccaaaggactatagtaacttagactgccaaagc
aaaatggtgcaagcacaaaagaaaagttttgaagagaaatatgccatcttcattgatgta
tgccagaagtttcaacctgtatttcgctatttctgtatggagaaatttctggatccagca
gtgtggtttgagaaacgtttggcatatactcgcagtgttgccacttcatcaatagttggc
tacatacttggtcttggagacagacatgtacagaatattctgttagatgagcaaagtgca
gagcttgttcacattgatctaggtgttgcttttgagcagggcaaaatccttcctacccca
gaaactgtgccatttaggctaacaagagatatagtagatgggatgggaatcactggcgta
gagggagtcttcaggagatgctgtgaaaaaactatggctgttatgcgcaactcccaagaa
gctttactaactattgtagaagtacttctctatgaccccctttttgactggaccatgaac
cctttaaaagccttgtatttgcagcaaaggccagaggatgaggccgatgttggctccagc
ctcaatgctgctgatcaaagttgcagcaaaaaagcaaatggtgataaccagacatttaat
aaagtggcagagcgggtcttgatgcgactccaggagaaactcaaaggagtggaggagggg
accgtgctcagtgtgggaggccaggtgaatcttctcattcagcaagctatggacccaaag
aatctcagccgcctcttcccaggatggaaagcatgggtctga

DBGET integrated database retrieval system