KEGG   Anolis carolinensis (green anole): 100556555Help
Entry
100556555         CDS       T01608                                 

Gene name
sdhb
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00020  Citrate cycle (TCA cycle)
acs00190  Oxidative phosphorylation
acs01100  Metabolic pathways
acs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100556555 (sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100556555 (sdhb)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100556555 (sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 100556555
NCBI-ProteinID: XP_003230358
Ensembl: ENSACAG00000016203
LinkDB All DBs
Position
Un
AA seq 264 aa AA seqDB search
MAASAVTAAKRASAAAAARVKRFAVYRWDPDKRGEKPRMQTYEVDLNKCGPMVLDALIKI
KNEMDPTLTFRRSCREGICGSCAMNIGGGNTLACTKRIDTDLGRTTKIYPLPHMFVVKDL
VPDLSNFYAQYKAIQPYLKKKDESRQGQEQYLQSIEDREKLDGLYECILCACCSTSCPSY
WWNGDKYLGPAVLMQAYRWMVDSRDDFTAERLAQLQDPFSLYRCHTIMNCTQTCPKGLNP
GKAIAEIKKMMAAYQKKEEGAATA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccgcggtgaccgcggcgaagagggcgagcgcggcggcggcggcgcgggtg
aaacgcttcgcggtgtaccggtgggacccggacaagcgcggggagaagccccggatgcag
acctacgaggtggacctcaataaatgtggcccaatggtgctggatgccctgatcaagatc
aagaacgaaatggaccccacgctcaccttccggcgctcctgcagggaagggatctgcggc
tcctgcgccatgaacatcgggggcgggaatactctggcctgcaccaagcgcatcgacacc
gacctcggccgcaccaccaagatctacccgctgccccacatgtttgtggtcaaggacctc
gtccccgacctgagcaacttctatgcccaatacaaggccatccagccctacctgaagaag
aaggacgagtcccgccaaggccaggagcagtacctccagtccattgaggaccgggaaaag
ctggacggcctgtatgaatgcatcctctgcgcctgttgcagcaccagttgccccagttac
tggtggaacggggacaaatacttaggccccgctgttctcatgcaggcctaccgctggatg
gtggactcccgcgacgacttcacggccgagcgcctggcccagctgcaggaccccttctcc
ctctaccgctgccacaccatcatgaactgcacccagacctgccccaagggcctgaatccc
ggcaaggccattgcggagatcaagaagatgatggccgcctaccagaagaaggaggaggga
gcagccacggcctag

DBGET integrated database retrieval system