KEGG   Anolis carolinensis (green anole): 100556723
Entry
100556723         CDS       T01608                                 

Gene name
mdm2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04120  Ubiquitin mediated proteolysis
acs04144  Endocytosis
acs04218  Cellular senescence
acs04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100556723 (mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100556723 (mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100556723 (mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    100556723 (mdm2)
   04115 p53 signaling pathway
    100556723 (mdm2)
   04218 Cellular senescence
    100556723 (mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100556723 (mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100556723 (mdm2)
   04121 Ubiquitin system [BR:acs04121]
    100556723 (mdm2)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100556723 (mdm2)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100556723 (mdm2)
Ubiquitin system [BR:acs04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100556723 (mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-FPG_IleRS zf-RING_2 DZR
Other DBs
NCBI-GeneID: 100556723
NCBI-ProteinID: XP_008114806
Ensembl: ENSACAG00000004204
LinkDB
Position
Un
AA seq 468 aa
MASALEPAAAGTSGSSGTSQETLVKPKPLLLKLLKFAGAQKDTFTMKEILLYIGQYIMSK
HLYDEKQQHIVHCANDLLGELFGVQSFSIKEQRQLYMMISKNLVTVSRQDNVNTTVNQSR
CQLENGSALKEFVQESNDATTSRRRAYSETEEHGSEDMNDERQSKRHKSDSISLTFDESL
SWCVVSGLYCDQNNSSSSAGSPASPDHNASLSDWLDDDSVSDQFSVEFEVESICSEEYSP
NEEGVELTDEDDEIYQVTIYQTEDSDMDSFDEDPEISLGDYWKCSHCNEMNPPLPPYCPR
CWTLREGWLPEKSEKSQMSKHENSTSLGPEKASELDQEDGFDVPDCKKGKINDDNKETGD
TEQSSESQESEAYSQPSTSSSILWSSQEDSKEPEKEDPGDKSPEPSLPLSSVEPCVICQT
RPKNGCIVHGRTGHLMSCFTCAKKLKKRNKPCPVCRQPIEMVVLTYFC
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggcttctgctctggagccggcagctgcgggcacatcgggcagcagtggcacctctcag
gaaacattggtgaaaccgaaaccattgttgctgaaacttttaaagtttgctggtgcacag
aaggatacttttactatgaaggaaatactcctgtatattggacaatatattatgtctaag
catctgtatgatgaaaaacagcagcatattgtccactgtgcgaatgatctcttgggagaa
ctctttggggtgcaaagtttttctataaaagaacagaggcaattatatatgatgatttcc
aaaaacctggtaactgtcagtcggcaagataatgttaacacaactgtgaatcagtccagg
tgccaactagaaaatggaagtgctctaaaggaatttgtgcaagaatcaaatgatgcaact
acttctaggaggagggcatacagtgagacagaagaacatggttcagaagatatgaatgat
gaaagacagagcaaacgacataaatcagacagcatttctcttacatttgatgaaagcctt
tcatggtgtgttgtaagcggattatattgtgatcaaaataacagtagcagctctgcagga
tctccagcaagtccagatcacaatgccagtttaagtgattggctagatgatgattctgtt
tcagatcaattcagtgttgagtttgaagttgaatctatctgttcagaagaatacagccct
aatgaagaaggcgttgaacttacagatgaggatgatgagatatatcaagtaactatatat
cagactgaagacagtgatatggattcgtttgatgaagatcctgaaatttcactgggtgat
tactggaagtgctctcactgcaatgagatgaacccacccctgccgccctattgtcctaga
tgctggacccttcgtgagggttggcttccagagaagtctgagaagtctcaaatgagcaaa
catgaaaactccacatcactaggccctgaaaaggcctcagagctcgatcaagaggatggc
tttgatgttccggattgtaagaaagggaaaataaacgacgataataaggaaactggggat
accgaacaaagctcagagtctcaggaaagcgaggcatattcgcagccatcaacatctagc
agtatactgtggagcagtcaggaagactctaaggaacctgagaaggaagaccctggagac
aaaagcccagaacccagtttacctttatccagtgtggaaccatgtgtgatatgccaaaca
cgccccaaaaatggctgcatagtacatggaaggacaggacatcttatgtcatgtttcacc
tgtgccaaaaaactgaagaagcggaacaagccatgtccggtctgccggcagccaatagaa
atggttgtgttaacttatttttgctaa

DBGET integrated database retrieval system