KEGG   Anolis carolinensis (green anole): 100557347
Entry
100557347         CDS       T01608                                 

Gene name
atf6b
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04141  Protein processing in endoplasmic reticulum
acs04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100557347 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100557347 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acs03000]
    100557347 (atf6b)
Transcription factors [BR:acs03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100557347 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA
Other DBs
NCBI-GeneID: 100557347
NCBI-ProteinID: XP_003218053
Ensembl: ENSACAG00000010535
LinkDB
Position
2
AA seq 707 aa
MVISGWESLQTKSGSKMAALASELLLLSDSSRFREDNLLSSEDWEAGLYSCLDNDGDMAT
ELFPCLGKSITTDDCGNSMLSDGFDLDMETTPPDPLWDSLQEIIFPRELQVKSEPVSPAS
SHCSDSSASSSDLSAVSSSSSDLPGQAPSPADVVGVKAEHPPTPPCMFGDVLSPPFGTVH
ISVVPAPDTGKLVASNKADCIFSRKPPIQPKPVVVTTVPVQPPTTSSKTILLQPVPVTQS
QSINPGISVPAQGVVISKSELLHLPVSGLIKVQSPVSEGLPAKLTPSTPKPEAKTIVPAP
TQIGPCNQEVDIKVLKRQQRMIKNRESACQSRRKKKEYLQGLESRLREALTENDRLRREN
TLLRRRLDCVLNENSELKFGSGNRKVICVMVVLLFIAFNFGPVSISEHKMTDVVLPKQEV
EPAPGQRHLLGIAGELPDIPEEEPEERQYEAPAKPGKTSFRNLSAPFSEMKDLMLRDINK
LFLTSDCRQFNRTESLRLADELSGWVRRHQINRRKPSQSRKAAQTSQGKQQKMPPNPSRF
VPANPPRHMERNSLHPLQVYQHPDHTEHDFMDAIDRREDTFYVVSFRRDHLLLPAISHNK
TSRPKMSLVMPAMALNESLYNSSLGYEVMMQIDCEVMDTRVIHIKSSTVPPFLRRQEAAP
DNRTQSSPPSFTGRATRTALRSHRSALSSSRRHPHRTLYFGEERGGG
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggtaatcagtgggtgggagtcactgcaaacgaaaagcggaagcaagatggcggcgctg
gcttcggagttattgctgctgagcgattcgagtcgcttccgcgaagacaatttgctgagc
agcgaggattgggaagctggtctttacagctgcttggataatgatggcgatatggcaact
gagctcttcccctgccttgggaagagtattacaactgatgactgtggcaattctatgtta
agtgatggatttgacctagacatggaaacaacccctccagatccactttgggactcactt
caagagattatcttcccaagagaattgcaggtgaagtctgagccagtctcccctgcctca
tctcattgctctgattcatctgcctcatcctctgatttgtctgctgtgtcttcctcctcc
tctgatctccctgggcaggcccctagcccagctgatgtggttggagtgaaggcagagcac
ccaccaacccctccctgcatgtttggagatgtcctttcacctccctttggcactgtccac
atcagtgttgttccagcacctgatacagggaaattggtagcttccaacaaagcagactgc
atcttcagccgaaagcctcccatccaaccgaagccagttgtagtaactactgtcccggta
caaccaccaaccacttccagtaagaccatcttactgcagcctgttcctgtgacccagtca
cagtctatcaacccaggaatttcagttccagcacagggtgttgtgatctccaaatctgag
cttctgcatcttccagtgtcaggtctgatcaaggttcaatcccctgtgagtgaaggtctt
ccagcaaaactgactccttccacacccaaaccggaagccaagacaattgtccccgcacca
acacaaattggaccctgcaaccaagaggttgatatcaaagtcttgaaacgccagcaaaga
atgattaagaaccgcgagtcagcctgccagtcgcggcggaaaaagaaagagtacctgcaa
gggttggagtcccgattgcgggaggccctgacagagaatgaccggctacggcgggagaac
actctcctccgtcgtcgcctggactgcgtcctgaatgagaacagcgaactaaaatttggt
tctggaaaccggaaagtcatctgcgtcatggttgtactgctcttcatagccttcaatttt
gggcctgtcagcatcagtgagcataagatgacagacgtggtccttcccaagcaggaagtg
gagcctgccccaggccagaggcatcttttagggattgcaggggaattgccagacattcca
gaagaggagccggaagagcgacaatacgaggccccagccaagcctgggaagacatcattc
cggaacctctcagctcccttctcagagatgaaggacctgatgttgagggatatcaacaag
ctcttcctcacttcagattgccgccagttcaaccgcactgaatcactcaggttggcagat
gagctcagtggttgggttcggcgacaccagatcaaccggaggaagccctcgcagtctcgt
aaagcagcacagactagccagggcaaacaacaaaagatgcctccaaacccctccaggttt
gttcctgccaaccctcctaggcacatggagagaaactccctgcatccgctacaggtatat
cagcaccctgaccacactgaacatgatttcatggatgccattgatcgccgagaagacacc
ttctatgtagtatccttccgcagggaccacttactgctgccagccatcagccacaacaag
acctctcggcccaaaatgtcactggtgatgccagccatggccctcaatgagagcctgtac
aattcctccctgggttatgaggtgatgatgcaaattgattgtgaggtgatggacacccgc
gtgattcacatcaagagctccacggtgccccctttcctgcggcgccaggaggcggccccc
gacaaccgcacccagtcctccccaccgtccttcaccggcagggccacccgcacggctttg
cggtcccatcgctccgctttgtcctcctccaggcggcacccgcatcgcaccctttatttc
ggagaggagcggggaggaggctag

DBGET integrated database retrieval system