KEGG   Anolis carolinensis (green anole): 100557584Help
Entry
100557584         CDS       T01608                                 

Gene name
glb1
Definition
(RefSeq) galactosidase beta 1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00052  Galactose metabolism
acs00511  Other glycan degradation
acs00531  Glycosaminoglycan degradation
acs00600  Sphingolipid metabolism
acs00604  Glycosphingolipid biosynthesis - ganglio series
acs01100  Metabolic pathways
acs04142  Lysosome
Module
acs_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100557584 (glb1)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100557584 (glb1)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100557584 (glb1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100557584 (glb1)
   00511 Other glycan degradation
    100557584 (glb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100557584 (glb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100557584 (glb1)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100557584 (glb1)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100557584 (glb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 100557584
NCBI-ProteinID: XP_003225808
Ensembl: ENSACAG00000013765
UniProt: H9GKJ9
LinkDB All DBs
Position
Un
AA seq 649 aa AA seqDB search
MFALFLLSLLCPALASSSSSSSVITSQRTFGIDYGHNCFLKDGQPFRYISGSIHYSRIPR
YYWKDRLLKMKMAGLDAIQTYVPWNFHEPERGVYNFTGDRDLEYFLQLAQEVGLLVILRA
GPYICAEWDMGGLPAWLLEKESIVLRSSDPDYLTAVGSWMGIFLPKMKPHLYQNGGPIIM
VQVENEYGSYFACDFDYLRYLQNLFRQYLGDEVVLFTTDGASMFYLRCGALQGLYSTVDF
GPGRNVTAAFSTQRHTEPKGPLVNSEFYTGWLDHWGHRHITVPASIVAKSLSEILASGAN
VNMYMFIGGTNFGYWNGANMPYMAQPTSYDYDAPLSEAGDLTEKYFAIREVIGMFKKLPE
GPIPPTTPKFAYGRVPLVKVGAVRELLNDLSPSGPVKSMYPLPFVQLKQYFGYVLYRTKL
PRNCTEETPLSSTFDGIHDRAYVSVDGVRQGILERSSLKKLNITGNAGADLDLLVENMGR
VNFGRFNNDFKGLISNVTLGEEILTDWEIYPLDIDRAVAEGLENKGNASSYEVPAFYIGS
FSIPSGIPDLPQDTYLTFPGWTKGQVWINGFNLGRYWPVAGPQQTLFVPSNILVASAPNN
ITVLELEESPHATQKYLVEFVDKPVFNASFHYGSSTEKLFTRELWMNYI
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccctcttcctgctctctctcctttgcccggccttggcatcatcatcatcatca
tcatccgttattacatcacagagaacttttggaattgattatggccacaactgtttcctc
aaggatgggcaaccgttccgttacatctcaggcagcatccattattcccgtattccccgg
tactattggaaagaccgcctcctgaaaatgaaaatggccggccttgatgctattcaaacc
tatgtgccatggaattttcatgaacctgagcgaggagtgtacaatttcacaggcgaccga
gatcttgaatatttcctgcagcttgctcaggaggttggcttgttggtcatactgcgagca
ggaccatatatttgtgctgaatgggacatggggggcttacctgcctggttattagaaaaa
gaatctattgtccttagatcttctgatccagattatttgacagcagtaggaagctggatg
gggattttcctaccaaagatgaagcctcacctttatcagaatggaggtccaattattatg
gtgcaggttgaaaatgaatatggaagttactttgcctgtgactttgattaccttcgttac
ctgcaaaatctttttcggcagtaccttggggatgaagttgttctatttactacagatggt
gcaagcatgttttacctgcgatgtggagctcttcaaggtctttattcaactgtggatttt
ggaccgggtagaaatgtgacagcggcattttcaacacagagacacaccgagcctaaaggc
cccttggtcaattcagagttctacactggctggctggatcattggggtcaccgtcatatc
actgtgccagcgtcaattgtagctaaaagtcttagcgagatcctggcgagtggtgctaat
gtgaacatgtacatgttcataggagggactaattttggctattggaatggagcaaacatg
ccttatatggcacagcctaccagctatgattatgatgctccactgagtgaagcaggagac
cttacagagaaatattttgccatcagggaggtaattggtatgttcaagaaattaccagag
ggccctatacctccaacaacccccaagtttgcttatggccgtgtcccactggtgaaggtg
ggtgcagtgagggagcttctcaatgatttgtcgccatcaggaccagtaaaatccatgtac
cctttaccatttgttcaattgaagcagtactttggatatgtattatacagaaccaagtta
ccaagaaactgtactgaagaaactcctctatcatcaacatttgatggaattcatgaccgt
gcctatgtctctgtggatggggttcgtcagggaattcttgaaagaagcagtctaaaaaaa
ctgaatataacagggaatgctggagcagatttggatttgttggtagaaaatatgggccga
gtaaattttggaaggttcaacaatgacttcaagggtctgatttccaatgttactcttggt
gaagaaatactcactgactgggaaatatatccattggacattgaccgtgcagtagctgag
ggcctggagaataaaggaaatgcgtcaagctacgaagtgcctgctttttatatcggtagc
ttttccattcctagtggaatccctgacttgccacaagacacctacttaacatttcctggt
tggacgaagggacaagtctggatcaatggctttaacctgggacgctactggccagtcgct
ggccctcagcaaacactgtttgttccaagcaacattcttgttgcatcggctccaaacaat
attacagttctggagctggaggagtccccacacgccacccagaaatatctggttgagttc
gtagacaagcctgttttcaacgcatcttttcactatggcagtagcactgagaagctgttc
actagagaattatggatgaattatatatga

DBGET integrated database retrieval system