KEGG   Anolis carolinensis (green anole): 100557978Help
Entry
100557978         CDS       T01608                                 

Definition
(RefSeq) sialidase-3
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00511  Other glycan degradation
acs00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100557978
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100557978
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100557978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR DUF4185 BNR_4
Motif
Other DBs
NCBI-GeneID: 100557978
NCBI-ProteinID: XP_008118889
Ensembl: ENSACAG00000025561
UniProt: H9GQ66
LinkDB All DBs
Position
Un
AA seq 394 aa AA seqDB search
MAEAPAGFGKVVLFHQGAPGGLTYRIPALLYLPSESAFLAFAEERSSPRDEDARFLVMRR
GQKQGTSVQWGPQESLMTATLPGHRTMNPCPLYERSSRTVFLFFICVQTEVTEQQQLRRG
KNAARLCYVSSRDGGRTWSQTTDLTEKAITDNLRRWATFAVGPGHGLQLSSGRLVVPAYA
YYIHRRCFGHPLTVWTKPHSFMFYSDDGGRNWSQGRLLRAVRTSECQVAELTGQDNRPVL
YCNARSPDRYRAEAFSADHGEFFDESFFSEELCEPPNGCQGSVMSFSPMAELGVHPSSAS
YENTKQWLIFSHPTNKRHRLDLGIYLNMSPMEKGSWKGPWVLNKGPSGYSDLAVCKERKS
LLFGCLFECGAANSYEEIAFKLFTDAELLREGRF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcaccagccggttttgggaaggtggttcttttccaccaaggagcgccagga
ggactcacctaccgcatcccagcgttgctgtacctgccgtctgaatccgctttcctggcc
tttgcggaagaacgctcctcgcccagagacgaagatgccaggttcctggtgatgcggcga
gggcaaaagcaaggaacgtccgtccagtggggtccgcaggaatctctgatgacggccaca
ttgccaggccaccgcactatgaacccttgcccactgtacgagaggagcagccggaccgtg
ttcctcttctttatctgtgtccagaccgaagtgacggagcagcagcagctcagaagaggg
aaaaacgccgccaggctgtgttacgtctcgagccgagatggaggccggacatggagccag
accacggacctgaccgaaaaggccattacggataacctgaggagatgggccactttcgcc
gttgggccgggccatggcctccagttgagctcgggccgattggtggtcccggcatacgct
tattatatccaccggcgttgctttgggcatccgctcaccgtctggacaaaaccccattct
ttcatgttctacagtgatgatggtgggaggaactggtcccagggccggctcctcagggcc
gtgcggacatcggaatgccaggttgctgaactgaccggccaggataatcgccccgtgttg
tactgtaatgcccggagtcccgacaggtaccgggcagaggccttcagtgcagatcatgga
gagttctttgatgaatcctttttctctgaggagttgtgtgaacctcccaatggatgccag
ggcagcgtcatgagcttttcgcccatggcagagctaggcgtccatccctcctcagcttcc
tatgagaacacaaagcaatggctgatcttctcccaccccacaaacaagcgccatcgcctg
gacctgggcatctacttgaacatgtcccccatggagaagggctcctggaaaggcccttgg
gtgctgaacaaagggcccagcggctattcggacctggccgtgtgcaaggagaggaagtct
ctgctctttggttgcttgtttgagtgtggagcagctaattcttatgaagaaattgccttc
aagctcttcactgatgctgagcttttgagggaagggcgattctga

DBGET integrated database retrieval system