KEGG   Anolis carolinensis (green anole): 100558035
Entry
100558035         CDS       T01608                                 

Gene name
src
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04012  ErbB signaling pathway
acs04137  Mitophagy - animal
acs04144  Endocytosis
acs04370  VEGF signaling pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04530  Tight junction
acs04540  Gap junction
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04912  GnRH signaling pathway
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100558035 (src)
   04370 VEGF signaling pathway
    100558035 (src)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100558035 (src)
   04137 Mitophagy - animal
    100558035 (src)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100558035 (src)
   04520 Adherens junction
    100558035 (src)
   04530 Tight junction
    100558035 (src)
   04540 Gap junction
    100558035 (src)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100558035 (src)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    100558035 (src)
   04625 C-type lectin receptor signaling pathway
    100558035 (src)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100558035 (src)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100558035 (src)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100558035 (src)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100558035 (src)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100558035 (src)
Protein kinases [BR:acs01001]
 Non-receptor tyrosine kinases
  SRC family
   100558035 (src)
Membrane trafficking [BR:acs04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100558035 (src)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    100558035 (src)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100558035 (src)
  Macropinocytosis
   Kinases
    100558035 (src)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 100558035
NCBI-ProteinID: XP_003225336
Ensembl: ENSACAG00000011859
UniProt: H9GID5
LinkDB
Position
Un
AA seq 532 aa
MGSSKSKPKDPSQRRRSLESTENIHGGCSASQTPNKTTVADAHRTPSRLFGSTTPEPKLF
GGSNTSDTVTSPQRCGALAGGVTTFVALYDYESRTESDLSFKKGERLQILNNTEGDWWLA
HSLTTGQKGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLARESETTK
GAYCLSVSDFDNAKGLNVKHYKIRKLDNGGFYITSRTQFSSLQQLVAYYSKHADGLCHRL
TNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGT
MSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMCKGSLLDFLKGEMGKYLRLP
QLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQG
AKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELATKGRVPYPGMVNREVLDQVERGYRM
PCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggggagcagtaagagcaaacccaaagatcccagtcaacggagacgcagcctcgaatcc
acagaaaatatccatggtggttgctctgcctctcaaacacccaacaagaccacagtcgca
gatgctcatcgaacccccagccgtttatttggaagcacaacaccagagccaaaactcttt
ggaggatcaaatacatctgatacagtcacctctcctcagcgttgtggagctctagctgga
ggagtcactacatttgtggccctttatgattatgaatcacggacagaatcagatctttct
tttaagaaaggggaacgcctccaaatcctcaataacacggaaggagattggtggctggct
cactctctcacaactggtcagaaaggctatatccccagtaactatgtcgcaccctcagac
tccatccaggctgaagagtggtattttggcaagataacccgccgagagtctgaacggcta
ctactcaatcctgaaaatcctcgaggaactttcctggcaagagagagtgagacaacaaaa
ggtgcctactgcctctctgtctcagattttgacaatgccaaaggactcaatgtgaagcac
tacaagatccgcaaactggacaatggtggtttctacatcacctctcgcacccaattcagc
agtcttcagcagctggtagcatattattccaaacatgcagatggcttgtgccaccgtctc
accaatgtctgcccaaccagcaagcctcagacacaaggccttgccaaggatgcttgggaa
attccccgggaatccctaagattagaagtgaagcttggacaaggctgctttggagaagtg
tggatggggacctggaatggcaccaccagggtagcaataaagactctgaaacctgggaca
atgtctccagaggcatttctacaggaagctcaggtcatgaagaaactgcgccacgagaag
ctggtgcagttgtacgctgtggtttctgaagaacctatttacattgtgacagaatacatg
tgcaaaggaagcctcttggatttcttgaagggtgaaatgggcaaatatctaaggctgccc
cagttggtggacatggctgcacagattgcatctggcatggcgtacgtggagagaatgaac
tatgttcacagagatctccgagctgccaatatccttgtcggggagaacctggtatgcaag
gtggctgattttggactggctcgcctgattgaggacaacgaatatacggcaaggcaaggt
gctaaattccctattaagtggactgctccagaagctgcgctctatggccggttcaccatc
aagtcagatgtatggtcctttggaatactgctgactgaactagccacaaaaggccgagtg
ccatatccaggtatggtgaaccgtgaagtgcttgatcaagtggaacgaggctaccggatg
ccctgcccacctgaatgcccagaatctttgcatgatctgatgtgccagtgttggaggaag
gatcctgaagaaagacccacctttgagtaccttcaagctttcttggaggattacttcaca
tcaacagaacctcagtatcagccaggcgagaacttatag

DBGET integrated database retrieval system