KEGG   Anolis carolinensis (green anole): 100558072Help
Entry
100558072         CDS       T01608                                 

Gene name
cdc23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04110  Cell cycle
acs04114  Oocyte meiosis
acs04120  Ubiquitin mediated proteolysis
acs04914  Progesterone-mediated oocyte maturation
Module
acs_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100558072 (cdc23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100558072 (cdc23)
   04114 Oocyte meiosis
    100558072 (cdc23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100558072 (cdc23)
Ubiquitin system [BR:acs04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100558072 (cdc23)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    100558072 (cdc23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_7 TPR_16 ANAPC3 TPR_11 TPR_17 TPR_12 DUF772 TPR_9 TPR_15
Motif
Other DBs
NCBI-GeneID: 100558072
NCBI-ProteinID: XP_003217641
Ensembl: ENSACAG00000006880
UniProt: G1KFX0
LinkDB All DBs
Position
2
AA seq 593 aa AA seqDB search
MAAASVAAVTVAAGAGLASADFSDLRTIKKQLLDVAERSRERGLQHSGKWASELAFALDP
LPLNELPPAPALTEEDARDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLYMYSRYL
SGEKKKDDETVDSLGPLEKGQVKNEVLRELRVELSKKHKARELDGFGLYLYGVVLRKLDL
VKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLI
EEALQKYQSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFS
NLLYVRGMKPELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRY
LGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRR
AHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESE
QAAQCYIKYIQDIHSCGEIVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCAFNDTRE
EGKALLRQILQLRNQGETSSTEIATPFLLPSSLSANNTPTRRVSPLNLSNITP
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgagcgtggcggcggtaacggtggcggccggggccggcttggcgagtgcg
gacttctccgacctgcggaccatcaagaagcagctgctggacgtggcagagcggagccgg
gagcgcggcctgcagcacagcgggaaatgggcctcggagctggcatttgccctggaccct
ctgcccttgaatgagctgccgcctgcgcctgcactcacagaggaagatgctcgtgactta
gacgcctacacacttgctaaatcttactttgatctcaaagaatatgatagggctgcttac
tttctccggggctgcaagagccagaaggcctacttcttatatatgtattctagatacctg
tcaggtgaaaagaagaaggatgacgagacagtggatagtctgggtcccttagagaaggga
caggtgaaaaatgaagttttgagggagttacgggtagagcttagcaagaaacataaagcc
cgagagctggatggattcggcctttatctgtacggggttgtattacgaaagcttgaccta
gtgaaggaggccattgatgtctttgtggaagctacccatgttttgcccttgcattggggg
gcttggctggagctgtgcaacttgattacagacaaagaaatgctgaagttcctgtccttg
ccagatacctggatgaaggagttctttttggcacacatctacacagaactgcagctgata
gaggaagccttgcagaagtatcagagccttattgatgcaggattctccaaaagcacctac
attatctcccagattgcagtggcttatcacaatatcagagatattgataaagcgttgtcc
atcttcaatgaactacgaaaacaagatccttataggatagaaaatatggacaccttttct
aatctgctgtatgttaggggaatgaagcctgagttgagctatctggcccacaacctgtgt
gagattgacaagtaccgtgttgagacctgctgtgtgattggaaattactatagtttacgt
tcccaacatgagaaggcagcactttatttccagagggcattaaaactgaatccccgatac
ctgggagcatggactctcatggggcatgaatacatggagatgaaaaatacatcagcagct
attcaggcatacagacatgccatagaagttaataaaagagactacagagcatggtatgga
ctgggacaaacatatgaaattcttaagatgcctttttattgcctctattactatcgacga
gcccatcagctcagacccaatgattcacgaatgctggttgctcttggagaatgttatgag
aaattaaatcagctagtagaagctaaaaagtgttactggagagcatatgctgttggagat
gtggaaaaaatggcactggtgaaattagcgaagcttcatgaacagttgaatgagtcggag
caagcggctcagtgttatatcaaatacatccaagatatacattcctgtggggagattgtg
gagcatctggaagtgagcactgccttccgctacttggctcagtattatttcaagtgcaaa
ctctgggatgaagcttcagcgtgtgcccagaaatgctgcgcatttaatgataccagagaa
gaagggaaggccctcctgcgacaaatccttcagctaaggaatcaaggagagacatcctct
acagaaattgccacacccttcttacttccatcctcattgtctgccaataatactccaaca
cgccgtgtgtcaccactgaacttgtcaaatattacaccttaa

DBGET integrated database retrieval system