KEGG   Anolis carolinensis (green anole): 100558165Help
Entry
100558165         CDS       T01608                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00010  Glycolysis / Gluconeogenesis
acs00053  Ascorbate and aldarate metabolism
acs00071  Fatty acid degradation
acs00280  Valine, leucine and isoleucine degradation
acs00310  Lysine degradation
acs00330  Arginine and proline metabolism
acs00340  Histidine metabolism
acs00380  Tryptophan metabolism
acs00410  beta-Alanine metabolism
acs00561  Glycerolipid metabolism
acs00620  Pyruvate metabolism
acs01100  Metabolic pathways
Module
acs_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100558165 (aldh2)
   00053 Ascorbate and aldarate metabolism
    100558165 (aldh2)
   00620 Pyruvate metabolism
    100558165 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100558165 (aldh2)
   00561 Glycerolipid metabolism
    100558165 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100558165 (aldh2)
   00310 Lysine degradation
    100558165 (aldh2)
   00330 Arginine and proline metabolism
    100558165 (aldh2)
   00340 Histidine metabolism
    100558165 (aldh2)
   00380 Tryptophan metabolism
    100558165 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100558165 (aldh2)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100558165 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100558165
NCBI-ProteinID: XP_003225175
Ensembl: ENSACAG00000009091
LinkDB All DBs
Position
Un
AA seq 527 aa AA seqDB search
MWQAVLRSSRAAPLRLALLASRPLSAAAVPAPNPQPEVICNKIFINNEWHDAASKKSFPT
INPSTGEVICQVAEGDKADVDKAVKAAKEAFRFGSPWRRMDASHRSKLINRLADLIERDR
AYLAALETLDNGKPYSISYLVDLDMVVKNLRYYAGWADKIHGKTIPLDGDFFTYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKLAEQTPLTGLYVASLIKEAGFPPGVVN
VIPGFGKTAGAAISSHMEVDKVAFTGSTEVGHLIQKAAAESNMKRVTLELGGKSPNIIMS
DADMDWAVEQAHSALFFNQGQCCCAGSRTYVQEDIYHEFVERSVERAKSRVVGNPFDFKT
EQGPQVDEDQYNKILGYINAGKKEGAKLLCGGNPAADKGYFIQPTIFGEVQDDMTIAREE
VRNATQSLGPVMQILKFKSIEEVIHRANDTKYGLAAAVFTKDIDKANYISQGLRAGTVWI
NCYNVFGAQVPFGGYKASGQGREGGEYGLTPYMEVKTVTIKVPQKNS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggccgtgctgcgcagctcccgggcggctccgctccgcctggccctcctggcc
agcaggcctctctcggccgccgccgtcccggcccccaacccccagccggaggtcatctgc
aacaagattttcatcaacaacgaatggcacgatgcagccagcaagaaatccttccctacc
atcaacccatccacaggggaggtcatctgccaggtggcggagggagacaaggcggatgta
gacaaggctgtgaaggcggccaaggaggcattcaggtttggatctccttggagaaggatg
gatgcctctcaccggagcaagctgatcaaccgcttggctgacctgattgagagagatcgg
gcctatttggcggctctggaaacactggacaatggcaagccatattccatttcttatctg
gtggatttagacatggttgttaagaacctccggtactatgccggttgggcagacaagatc
catgggaaaacgattccccttgatggagacttctttacctatacgagacatgagcctgtg
ggggtttgtggacaaatcattccgtggaatttcccgctgctgatgcaggcctggaagctt
ggcccagcactggccacggggaatgtggtggtgatgaaactggctgagcaaaccccccta
acaggtttatatgtggccagtttgatcaaggaggccggtttcccgccaggggtggtgaac
gttattccaggctttgggaaaaccgcaggcgctgccatctcgtctcacatggaagtggac
aaagttgcattcacaggttccacagaggttggacatctgatccagaaggctgcagcagag
agtaatatgaaacgagtgacccttgagcttggtgggaagagccccaacatcatcatgtca
gatgctgacatggactgggctgtcgagcaagctcattctgccttattcttcaaccaagga
cagtgctgttgtgctggatctcggacatatgtccaggaagatatatatcacgagtttgtg
gagcggagtgtggaaagagccaaatccagagtggttggaaacccgtttgatttcaagaca
gaacagggacctcaggtagatgaagatcagtacaacaaaatccttggctacatcaacgct
gggaaaaaggaaggtgccaaactgctctgtgggggcaatcctgccgcagacaagggctac
tttattcagccaactatctttggagaagtgcaggatgacatgaccatcgccagagaggag
gtgaggaatgcaactcaatctttgggcccagtcatgcagatcctaaagttcaaaagtatt
gaggaagttatccacagagcaaacgataccaaatatggcttggcggcagcagtcttcacg
aaagatattgacaaagcaaactacatttcccaggggttacgtgccggaactgtctggata
aactgttacaacgtgtttggcgctcaggtcccatttggtggatataaagcatctggacaa
ggtcgtgaggggggagagtatggtctgacgccatacatggaagtgaaaacagtaactatc
aaagtcccgcagaagaattcttaa

DBGET integrated database retrieval system