KEGG   Anolis carolinensis (green anole): 100558174Help
Entry
100558174         CDS       T01608                                 

Definition
(RefSeq) sialidase-3-like
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00511  Other glycan degradation
acs00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100558174
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100558174
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100558174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Glyco_transf_36
Motif
Other DBs
NCBI-GeneID: 100558174
NCBI-ProteinID: NP_001315151
UniProt: K0PUS2
LinkDB All DBs
Position
Un
AA seq 423 aa AA seqDB search
MWDIPENMSRSEIGSGKVTLFRQEAPNGLTYRIPALLYLPSESAFLAFAEKRSSFRDEHA
EFLVMRRGKKGGMSVQWGLQESLVTAALPNHRTMNPCPVFEKTSGTIFLFFICVETPVTE
WHQITTGQNAARLCYVSSRDGGRTWSPTIDLTKQVIGNDLENWATFAVGPGHGIQLSSGR
LVIPAYTYYIHERRPGRVPTCSTRPHCFTLYSDDGGRNWTQGQLLRDLQTTECQVAELTH
WDESRVLYCSARSPDKSRAEAFGAVGGDRFEKSSLCKQLCEPPHGCQGSIVSFTPVPIPS
DGGRMEVVGESVHPLGLVSSSKSWLVFSHPTQGHKRLDLGLYLNISPLDQGSWKGPWVLH
KGPCGYSDLAFCEEGDQQVFGCLFECGTTRECEEIAFQLFTGDELLRNVAQSCSCGSSAA
EPQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtgggacatcccagaaaacatgtccagatctgaaatcggctctgggaaagtgactctt
ttccgccaagaagcgcccaacggcttgacttaccgcatcccggccttgctgtacctgcct
tcggagtcggctttcctggcgtttgccgaaaaacggtcctctttccgggatgaacacgca
gagttcctggtgatgagaagagggaagaaaggggggatgtcagtccagtggggcctgcaa
gaatccctcgtgacggccgcgctgcccaaccaccgcaccatgaacccatgccccgtgttc
gagaagacttccggcaccatcttcctcttcttcatatgtgtggagacccccgtcacggag
tggcaccagatcacaacaggacaaaacgctgccaggctgtgctacgtctccagtcgcgac
ggtggccgcacttggagcccgactattgacttgaccaagcaggtgatcggcaatgattta
gaaaattgggccactttcgctgtcggacccggccacgggatccagttgagctctggtcgg
ctggtgatcccagcttatacctactacatccacgaacgtcgtcctggacgtgtgccgacc
tgctctacccgacctcattgcttcactttgtacagcgacgacggtggccggaattggacc
cagggccagctgcttcgggatttacagacaaccgagtgccaggttgccgaactgacccat
tgggacgagagtcgggtcttgtattgcagcgcccgcagtcccgacaagagccgggccgag
gcttttggggcggttggcggagaccgattcgagaaatcctccttgtgcaaacagttgtgc
gagccgccacacggttgccagggaagcatagtgagcttcactccggtgccgataccctcc
gatgggggccgaatggaagtcgtcggtgaatcagtccacccgttaggtcttgtttcttcc
tccaaatcgtggctggttttctcccatcccacgcaggggcacaagcgtctagacttgggc
ctctacctgaatatctccccattggatcaggggtcctggaagggcccctgggtgctgcac
aagggcccctgcggatactcagacctggccttctgtgaggagggggaccagcaggtattt
ggctgcctgtttgaatgcggcaccacccgcgagtgcgaagaaattgcctttcagttattt
acgggtgacgagctcctgaggaacgtggcacagagctgctcttgcggcagttctgcagcc
gagccacaatag

DBGET integrated database retrieval system