KEGG   Anolis carolinensis (green anole): 100558211
Entry
100558211         CDS       T01608                                 

Gene name
mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04137  Mitophagy - animal
acs04140  Autophagy - animal
acs04141  Protein processing in endoplasmic reticulum
acs04210  Apoptosis
acs04217  Necroptosis
acs04310  Wnt signaling pathway
acs04510  Focal adhesion
acs04530  Tight junction
acs04620  Toll-like receptor signaling pathway
acs04621  NOD-like receptor signaling pathway
acs04622  RIG-I-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04920  Adipocytokine signaling pathway
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100558211 (mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100558211 (mapk10)
   04012 ErbB signaling pathway
    100558211 (mapk10)
   04310 Wnt signaling pathway
    100558211 (mapk10)
   04068 FoxO signaling pathway
    100558211 (mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100558211 (mapk10)
   04137 Mitophagy - animal
    100558211 (mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    100558211 (mapk10)
   04217 Necroptosis
    100558211 (mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100558211 (mapk10)
   04530 Tight junction
    100558211 (mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100558211 (mapk10)
   04621 NOD-like receptor signaling pathway
    100558211 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    100558211 (mapk10)
   04625 C-type lectin receptor signaling pathway
    100558211 (mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100558211 (mapk10)
   04920 Adipocytokine signaling pathway
    100558211 (mapk10)
   04912 GnRH signaling pathway
    100558211 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    100558211 (mapk10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100558211 (mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100558211 (mapk10)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100558211 (mapk10)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100558211 (mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like RIO1
Other DBs
NCBI-GeneID: 100558211
NCBI-ProteinID: XP_008109223
Ensembl: ENSACAG00000011795
LinkDB
Position
5
AA seq 464 aa
MSRHFLYYCGEPTLDVKIAFCQGFGKQVDVSYIAKYYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKSLEEFQDVYLVMELMDGNLCQVFKWELDHERMSYLLYXMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagccgccatttcttatactactgcggtgaacctaccctggatgtgaagattgccttt
tgtcagggattcgggaaacaagtggatgtgtcatatattgccaaatattacaacatgagt
aaaagcaaagttgacaaccagttctacagtgtggaagtgggtgactcgaccttcacagtt
ctcaagcgctaccagaacttaaaaccgattggctctggagctcagggaatagtttgtgct
gcatatgatgctgttctcgacaggaatgtggccatcaagaagctcagcaggccgtttcaa
aaccagacacacgctaagcgagcttaccgagaactagtcctcatgaaatgtgtgaatcac
aaaaacattatcagtttattaaatgtcttcacaccacagaaatctctggaggagttccag
gatgtttatttagtaatggaactgatggatggcaacttgtgccaggttttcaaatgggaa
ctagaccatgaacggatgtcttacctgctctacnaaatgctttgtggcatcaaacatctt
cattctgcaggaattattcacagggatttaaaaccaagtaatattgtggtaaaatcagac
tgtacgttgaagatcctagattttggactggccagaactgcaggcactagcttcatgatg
actccctatgtggtcacacggtattacagagcaccagaggtcatcttgggaatgggctac
aaggagaacgttgacatgtggtcagtaggttgcatcatgggagaaatgattaaaggtgct
gtgttgtttcctggcactgatcatattgatcagtggaataaggtaattgaacagctggga
accccttgcccggaattcatgaagaaactgcaaccaacagtgcggaactatgtggaaaac
agacctaaatatgccggcctcaccttccccaaactattcccagattctctctttcccgcc
gattcagaacacaacaaactcaaagctagccaagccagggaccttttgtcaaagatgcta
gtgattgacccagccaaacggatatcagtggatgaagccttacagcatccgtacattaat
gtctggtatgacccggcagaagtggaggcaccacctccacagatatatgataagcagctg
gatgaaagagaacacacaatcgaagagtggaaagaattaatctacaaggaagtcatgaac
tctgaagaaaagactaaaaatggtgtagtaaaaggacagccttctccctcaggtgcagca
gtgaacagcagcgaaagcctccctccatcctcatccgtcaatgacatttcctccatgtcc
acagaccagaccctggcatcagacactgacagcagtttggaagcttctgcaggacccctc
ggttgttgcaggtga

KEGG   Anolis carolinensis (green anole): 100561907
Entry
100561907         CDS       T01608                                 

Gene name
mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04137  Mitophagy - animal
acs04140  Autophagy - animal
acs04141  Protein processing in endoplasmic reticulum
acs04210  Apoptosis
acs04217  Necroptosis
acs04310  Wnt signaling pathway
acs04510  Focal adhesion
acs04530  Tight junction
acs04620  Toll-like receptor signaling pathway
acs04621  NOD-like receptor signaling pathway
acs04622  RIG-I-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04920  Adipocytokine signaling pathway
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100561907 (mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100561907 (mapk8)
   04012 ErbB signaling pathway
    100561907 (mapk8)
   04310 Wnt signaling pathway
    100561907 (mapk8)
   04068 FoxO signaling pathway
    100561907 (mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100561907 (mapk8)
   04137 Mitophagy - animal
    100561907 (mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    100561907 (mapk8)
   04217 Necroptosis
    100561907 (mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100561907 (mapk8)
   04530 Tight junction
    100561907 (mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100561907 (mapk8)
   04621 NOD-like receptor signaling pathway
    100561907 (mapk8)
   04622 RIG-I-like receptor signaling pathway
    100561907 (mapk8)
   04625 C-type lectin receptor signaling pathway
    100561907 (mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100561907 (mapk8)
   04920 Adipocytokine signaling pathway
    100561907 (mapk8)
   04912 GnRH signaling pathway
    100561907 (mapk8)
   04914 Progesterone-mediated oocyte maturation
    100561907 (mapk8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100561907 (mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100561907 (mapk8)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100561907 (mapk8)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100561907 (mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100561907
NCBI-ProteinID: XP_003225439
LinkDB
Position
Un
AA seq 553 aa
MKAFDNTLTVFKQGFRWDASFRSNGIKLEAPSESALRGHGNPIGDRGHITLPQPQRSLHS
EQNRKRREGAPRTGSQGKAATRRCGTGDVTPPGHRERRMRKRPANQSRPETPPRCPSRLC
LSPCSAARGGGRGGGGGGGASQPGAGRHPPRVLSARFMSFKLRCSFNGIMSRSKHENNFY
SVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAY
RELVLMKCVNHKNIIGLLNVFTPQKLLEEFQDVYIVMELMDANLCQVIQMELDHERMSYL
LYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYY
RAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKK
LQPTVRTYVENRPKYAGYSFEKLFPDVLFPVDSEHNKFKASQARDLLSKMLVIDASKRIS
VDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYNEVIELEEKTKNGI
IRGQPSPLAQVQQ
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgaaagccttcgacaacacattaacagttttcaagcagggtttcaggtgggatgcctcc
ttcagatccaatgggataaagctcgaggccccttcagaaagcgcgctgcgtggccatggc
aacccaataggcgaccgtggacacatcacacttcctcagcctcaaaggagccttcactct
gaacaaaaccggaaacggcgggaaggcgcgccaagaacgggcagccaggggaaggccgcc
acgcgcaggtgcggcaccggtgacgtcactccgcctggtcaccgcgagcggcggatgcgg
aagaggcccgccaaccagagcagaccggaaacgccgccgcggtgcccgtcccgcctatgc
ctcagtccctgctcagccgcccggggaggaggaagaggaggcggagggggaggaggagcg
tcgcagcccggcgccggccgccacccgcctcgggtgctctctgccagattcatgtctttt
aagttaaggtgttcatttaacggaatcatgagcagaagcaaacatgaaaacaacttctac
agtgtagagattggagattctaccttcactgtactcaaaagataccagaatttaaaaccc
attggctcaggtgctcagggcatagtatgtgcagcctatgatgctatccttgaaagaaat
gttgcaatcaaaaagctaagtaggccatttcagaaccaaacccatgcaaaaagagcctac
agagaacttgttctcatgaagtgtgtaaatcacaaaaatattattggcctgttgaatgtc
ttcactccacagaagttgctagaagaatttcaagatgtttacatagtgatggagctcatg
gatgcaaatctctgccaggtgattcagatggagcttgaccatgaacgcatgtcctatctc
ctctatcagatgttgtgtggtattaagcatcttcactcagctggaattatacatagggat
ttgaaacctagcaatatagtagtaaaatctgactgcactttgaagattcttgactttgga
ctggctagaacagcaggaaccagttttatgatgacaccttatgtagtgactcgttactac
agagcaccagaagtcatcttaggaatgggatacaaagaaaatgttgatatttggtcagtg
gggtgcatcatgggagaaatgatcaaaggtggtgtattatttcctggtacagaccatatt
gatcagtggaataaagttattgagcaactaggaaccccatgccctgaattcatgaagaaa
ctacaaccaaccgtaaggacctatgtggagaacaggcctaaatatgctggctatagtttt
gagaagcttttcccagatgtcctctttccagttgactctgaacacaacaaatttaaggcc
agtcaggcaagagatttgttatccaaaatgctggtgattgatgcctcaaaaagaatctca
gtagatgaagctctacaacacccttatatcaatgtctggtatgacccttcagaagcagaa
gcgcctcctccaaagataccagacaagcagttagatgaaagagagcatacaatagaagaa
tggaaagaactgatttacaatgaagttatagagctggaggagaaaaccaagaatggaatt
atacgcggacagccatctcctttagcacaggtgcagcaatga

KEGG   Anolis carolinensis (green anole): 100565814
Entry
100565814         CDS       T01608                                 

Gene name
mapk9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04137  Mitophagy - animal
acs04140  Autophagy - animal
acs04141  Protein processing in endoplasmic reticulum
acs04210  Apoptosis
acs04217  Necroptosis
acs04310  Wnt signaling pathway
acs04510  Focal adhesion
acs04530  Tight junction
acs04620  Toll-like receptor signaling pathway
acs04621  NOD-like receptor signaling pathway
acs04622  RIG-I-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04920  Adipocytokine signaling pathway
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100565814 (mapk9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100565814 (mapk9)
   04012 ErbB signaling pathway
    100565814 (mapk9)
   04310 Wnt signaling pathway
    100565814 (mapk9)
   04068 FoxO signaling pathway
    100565814 (mapk9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100565814 (mapk9)
   04137 Mitophagy - animal
    100565814 (mapk9)
  09143 Cell growth and death
   04210 Apoptosis
    100565814 (mapk9)
   04217 Necroptosis
    100565814 (mapk9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100565814 (mapk9)
   04530 Tight junction
    100565814 (mapk9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100565814 (mapk9)
   04621 NOD-like receptor signaling pathway
    100565814 (mapk9)
   04622 RIG-I-like receptor signaling pathway
    100565814 (mapk9)
   04625 C-type lectin receptor signaling pathway
    100565814 (mapk9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100565814 (mapk9)
   04920 Adipocytokine signaling pathway
    100565814 (mapk9)
   04912 GnRH signaling pathway
    100565814 (mapk9)
   04914 Progesterone-mediated oocyte maturation
    100565814 (mapk9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100565814 (mapk9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100565814 (mapk9)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100565814 (mapk9)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100565814 (mapk9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100565814
NCBI-ProteinID: XP_003217513
Ensembl: ENSACAG00000016677
UniProt: G1KSZ8
LinkDB
Position
2
AA seq 424 aa
MSESKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSDSDRDKLKTSQARDLLSK
MLVVDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERNKNGLVKEQPSDAAVNSNTSPSQSSSINDISSMSTEQTLASDTDSSLDALTGTL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgaaagtaaatgtgatagtcagttttacagtgtacaagttgcagattcaacgttt
actgtactaaaacgataccagcaattgaaacctattggttctggggcgcaaggcattgtt
tgtgctgcatttgatacagtccttggaataaatgttgctgttaagaaactgagtcgccct
tttcaaaaccaaacacatgcaaaacgagcctacagggaacttgtactcttaaagtgtgtc
aatcataaaaatattattagtctattaaatgtattcacaccccagaaatcactagaagaa
tttcaagatgtgtatttggttatggaactgatggatgctaatttgtgccaagttattcat
atggaactggatcatgaaagaatgtcctaccttctatatcagatgttatgtggtatcaaa
catcttcattcagctggtatcatccacagagatttaaaacccagcaatatagtagtaaag
tcagattgtactcttaaaatccttgactttggcctggcaaggacagcatgtactaatttc
atgatgactccatatgtggttacacgatattacagagcaccagaagttattcttggaatg
ggatacaaagagaatgttgatatctggtcagttggttgcatcatgggagaattggtgaaa
ggttgtgtgatattccaaggcactgatcatattgaccagtggaataaagttattgaacag
ttaggtacaccatcagcagaatttatgaagaaactacagcctactgtgaggaactatgta
gaaaatagaccaaaatatccaggtattaaatttgaagagctcttcccagactggatattt
ccatcagactccgatcgtgacaaattaaaaactagtcaggctagagatttgctttcaaaa
atgctagttgtagatccagacaaacgaatttcagtagatgaagctttacgtcacccctat
atcactgtttggtatgacccagctgaagctgaagctccaccacctcaaatctatgatgca
caattggaagaaagggaacatgccattgaagaatggaaagaactaatttataaagaagta
atggattgggaagaaagaaataagaatggtttagtaaaagaacaaccttcagatgcagca
gtgaatagcaataccagcccttctcagtcatcatcaatcaatgacatttcatccatgtca
acagaacaaacactggcttcagacacagacagcagccttgatgctttgacaggaacactt
gaaggatgccggtga

DBGET integrated database retrieval system