KEGG   Anolis carolinensis (green anole): 100558229
Entry
100558229         CDS       T01608                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00230  Purine metabolism
acs01100  Metabolic pathways
acs04020  Calcium signaling pathway
acs04114  Oocyte meiosis
acs04261  Adrenergic signaling in cardiomyocytes
acs04270  Vascular smooth muscle contraction
acs04371  Apelin signaling pathway
acs04540  Gap junction
acs04912  GnRH signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100558229 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100558229 (adcy3)
   04020 Calcium signaling pathway
    100558229 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100558229 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100558229 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100558229 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    100558229 (adcy3)
   04916 Melanogenesis
    100558229 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100558229 (adcy3)
   04270 Vascular smooth muscle contraction
    100558229 (adcy3)
Enzymes [BR:acs01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100558229 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Vpu
Other DBs
NCBI-GeneID: 100558229
NCBI-ProteinID: XP_016852043
LinkDB
Position
Un
AA seq 1122 aa
MPRNRAFSEPEYSAEYSADYSVSLPSDPEHGVGARTHEVTVRNSGSCLCLPRFMRLTFTP
ESLENLYQTYFRRQRHETLLVLVVFAALFDCYVIIMCAVVYTSEKLPPTLAAAVGLATQV
LLFVLCKYELLPDRVTRKFVPYVLWILITAQIFCYLGLNFARFHEASDTVGWQAFFVFSF
FITLPLRLMPIVLISSVSCGIHTLVLGVTIAQQEQQQHQRQENTSGKDLLWQILSNVAIY
LCTICVGIMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLK
DMKKDPSQKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDK
LAAKYHQLRIKILGDCYYCICGLPDFREDHAVCSIMMGLAMVEAISYVREKTKTNVDMRV
GVHSGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMNCLKGEFEVEPG
DGGSRCEYLKEKGIVTYLVLVPKQPLKNGINGVKLSVSSSHGNSPQLINTKECNGSINTT
CTTPDEAEELDTRVVNPSFPNPRRRLRLRDLAERVVDASENEQELNKLLNEALLERESVQ
ALKGRSTFRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTAVVEIFIDPRLEANY
VTFIIGEILLLILTVCSLAAIFPRVFPRKLVAFSTWIDRTRWARNTWAMSAIFIITMADI
VDMLSCKQHYTVFNATKVELLAKGCVENPKYYSYIAVLALIATIMLVQVSHMVKLTLMVL
ITSIVGVVNILVWRQIFDTYDKKRFQESTNSLVSSKYSMTVMILVMMLSFYYFSRHVEKL
ARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPDHVARHFLGSKKRDEELYSQSYDEIG
VMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDDPQFRCITKIKTIGSTYMA
ASGVTPDISTNGYNNTVKKEDLSEKERWQHLADLADFALAMKETLMNINYQSFNNFMLRI
GMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHLVLKEYGFRFVR
RGHIYVKGKGDLLTYFMKGREKQGSIVNGSCVTLPHQVVDCS
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgccccgcaacagggctttctcggagcccgagtactcggccgaatactcagcggactat
tcggtcagcttgccctcggaccctgagcatggggtgggtgcccggacccatgaggtcacg
gtgcggaactcgggttcctgcctctgcctcccacgcttcatgcgcctgaccttcacccca
gagtccttggagaacctctaccagacctatttccggcgccagcgccacgagacgctcctg
gtgctggtggtctttgccgccctcttcgactgctatgtcatcatcatgtgcgccgtggtc
tacacctcggagaagttgccacccaccctggctgcggcggtggggctggccacccaggtc
ctcctcttcgtcctatgcaagtacgagctcctcccggaccgtgtcacccggaagttcgtg
ccctacgtcctgtggatactcatcaccgcccagatcttctgctacctgggcctgaacttt
gcccgcttccacgaggccagcgacacggtgggctggcaagccttcttcgtcttctccttc
tttatcaccctccctctgcgcctcatgcccatcgtcctgatctcttcggtctcctgcggc
atccacacactcgtcttgggggtcaccattgcgcaacaggagcagcagcaacatcagcga
caggaaaacaccagtgggaaagacttgttgtggcagatcttgtccaacgtggccatctac
ttgtgcaccatctgcgtgggcatcatgtcgtactacatggcggaccgcaagcaccgcaaa
gccttcctcgaagcccggcagtcgctggaggtcaagctcaacctggaggagcaaagccag
cagcaggagcgcttgatgctttccattttgcccaaacatgtggccgacgagatgctgaag
gatatgaagaaggatccgagccagaaggagatgcagcagtttaacaccatgtacatgtac
cgccatgaaaacgtcagcatcctctttgcggacatagtcggtttcacgcagctctcatct
tcctgcagcgctcaggaattggtgaaacttctcaacgaactctttgctcgctttgataaa
ctagccgccaagtatcatcagctccggatcaagatcctgggagactgctattactgcatc
tgcggactgccagatttccgggaagaccatgccgtttgctccatcatgatgggtcttgcg
atggtggaagccatttcctacgtgcgggagaagaccaaaacgaatgtggacatgcgtgtg
ggtgtgcacagcggcaccgtccttggcggggtcctggggcagaaacgctggcagtatgac
gtgtggtcgacagacgtgactgtggcgaacaaaatggaagctggaggcatcccggggcgt
gtgcacatttcccaaagcaccatgaactgcttgaaaggggagttcgaggtggagccggga
gatggtgggtcgcggtgtgaatacctgaaggagaagggcattgtcacttacctggtcctc
gtgcccaagcagcccctcaagaacgggatcaacggggtgaagttgtccgtctcgtcctca
cacgggaactcgccacagttgatcaataccaaagaatgcaacgggagcatcaacaccact
tgcaccactccggacgaggcagaggaactggacacaagagtggtcaacccctcttttccg
aatcctcgtcggcgcctgcgtttgcgagacctggccgagagggtggtggatgcgtccgag
aacgagcaggaactcaacaagttactcaacgaagccttgttggagagggagtccgtgcag
gcgctgaaggggagatccacgttccggctctccatgcgcttcattgaccccgagatggag
acgcgctactccgtggagaaagagaagcagagcggggcagccttcagctgttcctgtgtc
gtcctcttcttcaccgcggtggtggagatcttcatcgatccgaggttggaagcaaattat
gtgacattcatcattggcgagatccttttgctcatcctgaccgtttgctctctggctgcc
atctttcccagggttttcccaaggaaacttgtggctttctccacctggatcgaccggaca
cgatgggccaggaacacgtgggcgatgtctgccattttcatcatcaccatggcagacatc
gtggacatgctcagctgcaagcaacactacaccgttttcaatgccacgaaggttgagctg
ctcgcgaagggctgcgtggagaaccccaagtactacagctacatcgctgtcctggcgctc
attgccaccatcatgctggtccaggtcagccacatggtcaagctcaccttgatggtgctg
atcacctcgatcgtgggcgtcgtcaacatcctggtctggaggcagatcttcgatacgtac
gacaagaagcgcttccaagagagcacgaactcgctggtttcatccaaatactccatgacg
gtcatgattttggtgatgatgctcagtttctactatttctcccgccatgtggagaagctg
gcccggactttattcctgtggaagatcgatgttcacgaccagaaagagcgggtctatgag
atgcggcgctggaacgaggccctggtcaccaacatgcttccggatcatgtggcgcggcat
ttcctggggtccaagaagcgggatgaggagctgtacagccagtcttacgatgagatcggg
gtcatgtttgcctctcttcccaacttcgccgacttctacaccgaggagagcatcaacaac
ggtgggatcgaatgcctgcgcttcctcaatgagatcatttcggattttgatgcactccta
gacgacccccagttccgatgcatcaccaagatcaaaaccattggcagcacctacatggcg
gcttcaggcgtgacgcccgacatcagcaccaacggttacaacaacacggttaagaaggaa
gacctttctgaaaaggagcgctggcagcacttggcggatctggctgactttgccttggcc
atgaaagagaccttgatgaacatcaactaccagtcctttaataacttcatgcttcgaata
ggaatgaataaaggcgcagtgctggccggcgtcattggtgcccgcaaacctcactacgac
atttgggggaacactgtgaacgtggccagccggatggagtccacgggcgtcatgggcaac
atccaggtggtagaggaaacgcacctggtcctgaaggagtacggcttccgctttgtgcgc
cgaggccacatatacgtcaagggcaaaggtgacctgctcacctacttcatgaaagggagg
gagaagcaaggctccattgtcaacggctcctgcgtgacgctgccccaccaagtggtcgac
tgctcttga

DBGET integrated database retrieval system