KEGG   Anolis carolinensis (green anole): 100558317
Entry
100558317         CDS       T01608                                 

Gene name
serpine1
Definition
(RefSeq) serpin family E member 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04218  Cellular senescence
acs04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100558317 (serpine1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100558317 (serpine1)
   04218 Cellular senescence
    100558317 (serpine1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acs01002]
    100558317 (serpine1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100558317 (serpine1)
   00536 Glycosaminoglycan binding proteins [BR:acs00536]
    100558317 (serpine1)
Peptidases and inhibitors [BR:acs01002]
 Peptidase inhibitors
  Family I4: serpin family
   100558317 (serpine1)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100558317 (serpine1)
Glycosaminoglycan binding proteins [BR:acs00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   100558317 (serpine1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 100558317
NCBI-ProteinID: XP_003230796
Ensembl: ENSACAG00000001241
LinkDB
Position
Un
AA seq 411 aa
MRPPTQLLALAWAFLLGLTCAAPSAPSPPVLRLGLRTTDLGARLFREATSAASSRHRNLA
FSPPGVASVLAMLQAASGGGTRSQIEAGAGFRLRERGVPRALRQLQKALTEPRPEEEAEA
VTVSTADALFVQRDLVLKAGFLPSFQRVFRQAVKQVDFMEPDRARSIINAWVEKHTEGMI
QGFLREGLLDQLTRLLLVDAIHFQGQWALPFPEASTRRRLFHKPDGSTVSVPMMQQTARF
NYGEFSTPEHMEYDVIELPYQGETLSMLIAAPFEVDAPLSALTAILSAHLVDQWKSNMTR
VTRLLVLPKFSLESELDLRRPLEALGMTDMFDARKADFSSLSDEEPLFVAQALQKVKIEV
NESGTKASAATAAIVYSRMAPLEMVLDRPFLFLVRHNPTGTVLFMGQVMEP
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgcgacctccgacccagctcctggccttggcctgggccttcctgctgggcttgacctgt
gcggccccctcggccccctcccccccagtcctgcgcttgggcctccggaccaccgacttg
ggggcccggctcttccgtgaggcgacgtccgcggcctcctcccggcaccggaacctggcc
ttctctcccccgggcgtggcctcggtgctggccatgctgcaggcggcgtccggcggaggg
acccgcagccagatcgaggccggcgccggtttccggctgcgagagcgtggggtcccccga
gccctgcggcagctgcagaaggcgctgacggagccccggccagaggaagaggcggaggcg
gtgaccgtgtccacggcagatgccctctttgtccagcgggacttggtcctgaaggccggg
ttcctgccaagcttccagcgggtcttccgccaagcggtcaagcaagtggacttcatggag
ccagaccgtgcccgcagcatcatcaacgcctgggtggagaagcacactgagggcatgatc
cagggcttcctgcgcgaagggctgcttgaccagctgacccggctgctgctggtggacgcc
atccacttccagggccagtgggcgctgcccttcccggaggcctccacccggcggcgcctc
ttccacaagccggacggcagcaccgtctccgtccccatgatgcagcagactgcccggttc
aactacggcgaattctccaccccggagcacatggagtatgacgtcattgagctgccctac
cagggggagaccctcagcatgctcattgcagcccccttcgaggtggacgccccgctttct
gccctgaccgccatcctgagtgcccatctggtggaccaatggaagagcaacatgacgcgg
gtcacccgcctcctggtcctgcccaagttctccttggagagcgagctggacctgaggcgc
cccctggaggcgctgggcatgaccgacatgtttgacgcccgcaaggccgacttcagcagc
ctctcagatgaggagcccctctttgtggcccaggccttgcagaaggtgaagatcgaggtg
aacgagagcgggaccaaggcctctgccgccacagccgccatcgtctattcccgaatggct
cccctggagatggtcctggacaggcccttcctcttcctggtgcggcacaaccccacaggc
acggtgctcttcatggggcaagtgatggagccctga

DBGET integrated database retrieval system