KEGG   Anolis carolinensis (green anole): 100558697
Entry
100558697         CDS       T01608                                 

Gene name
ppm1d
Definition
(RefSeq) protein phosphatase, Mg2+/Mn2+ dependent 1D
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100558697 (ppm1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acs01009]
    100558697 (ppm1d)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100558697 (ppm1d)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    100558697 (ppm1d)
SSDB
Motif
Pfam: PP2C PP2C_2 DUF4298
Other DBs
NCBI-GeneID: 100558697
NCBI-ProteinID: XP_016852446
Ensembl: ENSACAG00000015320
UniProt: H9GM73
LinkDB
Position
Un
AA seq 541 aa
MEAGAGCALAVSLFSDQGGRKYMEDVTHILVEPEKEAEAEAAKARSVAFFAVCDGHGGRE
AALFAREHLWAFIKKQKGFRSAEPRAVCAALRKGFLACHRAMWKQLPEWPKTMSGLPSTS
GTTASVVIIRGSKMYVAHVGDSGVVLGVQDDPKDDFVRAVEVTQDHKPELPKERQRIEGL
GGSVINKSGVNRVVWKRPCLTHNGPVRRSTVMDQIPFLAVARALGDLWSYDFYSGEFIVS
PEPDTSVHTLDPQKHKYIILGSDGLWNMISPQEAISMCQDHEEKKYFMGEHQQSLAKMLV
NRALGRWRQRMLRADNTSAIVISISSGRSCHTDLESEEKLCFNLAEGPSYSSLEMWTQSQ
CSTLPVKAVEEDLLPRLSSPETVPLLPRSSTVLSNDSEDVAKGSLTLSKEGAAQEETLGP
RVRKSCRGSPPSALSPPSSGRADPDPTAFKASPNDGSKAHEPEHTPTGTNFKRTLEESNS
GPVVKKPRWGLARNAGAQTESLSATPQHKTPNKLAMRRSLRRQKKLGKPLFPQPRKALCV
C
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggaggccggggcggggtgcgcgctggcggtgagcctcttctcggaccagggcgggcgc
aagtacatggaggacgtgacccacatcctggtggagcccgagaaggaggccgaggcggag
gcggccaaggcccgctcggtggccttcttcgcggtgtgcgacgggcacggcgggcgggag
gcggccctcttcgcccgggagcacctctgggccttcatcaagaagcagaagggcttccgc
tcggccgagccccgcgccgtctgcgccgccctccgcaagggcttcctcgcctgccaccgc
gccatgtggaagcagctccctgagtggccaaagacgatgagcggccttccgagcacgtcg
gggacgacagccagcgtggtcatcatccggggctccaagatgtacgtggcgcacgtgggt
gactccggcgtggtgctcggcgtccaggacgaccccaaagacgactttgtccgggccgtg
gaggtgacgcaggaccacaagccggagctccccaaggagcggcagcggatcgaaggcctc
gggggcagcgtgatcaacaaatctggcgtgaatcgggttgtgtggaagaggccttgtctg
acacacaacggccctgtgaggcggagcaccgtcatggaccagatccctttcctggcagtg
gcccgggcccttggtgacctatggagctacgacttctacagcggcgaattcattgtgtct
ccagagccggacacgagtgtccacacgctggatccccaaaagcacaaatacatcattctg
ggcagcgatgggctgtggaacatgatctctccccaggaagccatttccatgtgtcaggac
catgaagagaagaagtattttatgggagagcaccaacaatccttggccaaaatgctggtg
aaccgagccctgggccggtggaggcagcgcatgctccgggcggacaacaccagcgccatc
gtgatcagcatctcttcgggtcggagctgccacacggacctggaaagcgaggagaagctg
tgcttcaacttggcggagggcccttcctacagcagcctcgaaatgtggactcagtcgcag
tgctccactctgccagtcaaggccgtggaagaggatctgttgccgcgcctgagttccccc
gagactgtccctttactcccacggagcagcactgttttgagcaatgactctgaggatgtc
gccaaaggcagcttgacgttgtctaaggaaggagcagcgcaggaggagaccctggggccg
agggtacggaagtcctgccgcgggagccccccgagcgcgctctctccgcccagttcaggg
agggcggacccagaccccacggccttcaaggcgtctccgaacgacggctcaaaggcccac
gagccggagcacaccccgacgggcacaaacttcaaacggactttggaagaatccaattcg
gggccggtggtcaagaagcccaggtggggtctggccaggaacgcgggggcccagacggaa
agcctgtccgcgacgccgcagcacaaaacccccaacaagctcgccatgcgccgcagcctc
cggaggcagaagaaactaggcaagccattgtttccacagcccaggaaagccttgtgtgtg
tgctga

DBGET integrated database retrieval system