KEGG   Anolis carolinensis (green anole): 100559144
Entry
100559144         CDS       T01608                                 

Definition
(RefSeq) uncharacterized LOC100559144
  KO
K10139  serpin B5
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100559144
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acs01002]
    100559144
Peptidases and inhibitors [BR:acs01002]
 Peptidase inhibitors
  Family I4: serpin family
   100559144
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 100559144
NCBI-ProteinID: XP_008114533
LinkDB
Position
Un
AA seq 814 aa
MDAVQIANTAFAVDIFKKLAEKDKTSNIIFAPLCTSTSLALAYRAAKGETATQMKQGLHL
EDVKDVPFGFQTITADASKLSSFYSLKMVKRLYVEKSLNPTTEFLSSIKRPFPSEFELAD
FKDKTEDTRLQINKSVSDLTDGKMENILIEGSVNDQTKILLINAAFFVTNWMKKFPENQT
KECPFRINKTETKPVQMMNLEATFCLGYINDLKTKILELPCHNKHMSMFIFLPKDIEDDT
TGLEQLEKQLTPEKMLQWTNPSSMANTKVNVFLPKFKMETEYDFKPILESLGMTHMFDES
SSDFSEMSENKGVVLSRIIHKVSLEVVEDGTESRDVPGYRILQHKDEFNANHPFLFAFKH
NKSRSIVFAGRFCSPGVAIVCKFQLPQTLDERALGRQDLLTPKTRSEIMDLSITKDSLPK
TITSFGLDLYKKLNKSDVCKNIFFSPMSISTALGMVLVGAWGNTKTQMGKVLHFDRSLED
TRSYAFQRRMADVSEPEKENVDGKINLEVKKLLSQLNHLNPGYQMNIANNLFIQRGYDFF
QQYLVCIKDVYGATLESVDFYNATEEARQTINLEVDKQTQGNIKELFPPGVIGPDTVLVL
ANAIYFKATWEHQFDPSRTTEKDFRLNENESKPVQMMHQRGRFQLGHVGSINAQILCLPY
VGELLSMIILLPKDISDLEQVENTMTCETLADWTSQQNMMEHHVDVYIPRFKLEDTFDLN
ITLQALGMTDVFDESKADLSGMSPSQQLFLSKVIHKAYVDVNEVGTEAAAATGASVSTRS
LISYELFLADHPFLFCIRHNPTNTILFLGKFCSP
NT seq 2445 nt   +upstreamnt  +downstreamnt
atggatgccgtgcaaatcgcaaacaccgcttttgccgttgatatattcaaaaagcttgcc
gaaaaggacaaaacttctaatattatttttgctccactttgtacttcaacctctctggct
cttgcctatagagctgccaagggtgaaacggcaacccaaatgaaacaggggcttcattta
gaagatgtcaaagatgtgccttttgggttccaaacaatcacagctgatgcttccaaactt
agttctttttattcattaaaaatggtcaagaggctctatgtagaaaagtcccttaaccct
actacggagtttctgagctccatcaaacgacccttcccatcagaatttgaattagcagat
tttaaagacaaaacagaagacaccaggctgcaaatcaacaaatctgtttctgatctgact
gatggtaaaatggagaacattttgattgaggggagtgtgaatgatcagacgaagatcctc
ctgataaatgcagccttttttgtaacaaactggatgaagaaatttcctgagaaccaaact
aaagagtgtccttttagaataaacaagactgaaaccaaacccgtgcaaatgatgaacctg
gaagccacattttgcctgggctacataaatgatctgaagaccaagattcttgaactcccg
tgtcataacaaacacatgagtatgttcatctttttgccaaaagatattgaggatgatact
actggattggaacagcttgagaagcagctcacacccgagaagatgctacagtggaccaat
ccaagttcgatggcaaacaccaaagtgaacgtgtttcttcccaaattcaaaatggaaaca
gaatatgacttcaagcctattttagaaagtcttggcatgacccacatgtttgatgaaagc
tcatcagatttctctgaaatgtcagagaacaaaggggttgtgttgtcccggatcattcac
aaagtctccctggaagtagttgaagatgggacagaatcccgagatgtaccaggatatcgg
atcctacaacacaaagatgaatttaatgctaaccatccatttcttttcgccttcaagcac
aacaaatcccgcagcattgtttttgctggcagattctgttctccaggagtggcgattgtt
tgtaaattccagctcccccagacacttgatgaaagagcactgggaagacaggatctctta
actcccaagacaaggagcgaaattatggatttaagcatcaccaaggattctcttcctaaa
acaattacatcatttggtcttgatctttataagaagctgaataaaagtgatgtgtgcaaa
aacatcttcttttctccaatgagcatttcaactgcactgggcatggtgctagtaggtgcc
tggggaaatactaagactcagatgggaaaggtgcttcactttgatagaagtctagaagat
acacgatcatatgcttttcaaagaagaatggcagatgtttcagaacctgaaaaggagaat
gtggatgggaaaatcaacctagaagtcaagaaactcttgtctcagttgaatcatctcaat
cctggctaccagatgaacatagcaaacaatttgttcatacaaaggggatatgattttttc
caacaatatcttgtatgcattaaggatgtctatggagctacactggaaagtgttgatttt
tataatgctactgaagaagcaaggcagacaattaaccttgaagttgacaaacagacacaa
ggaaacatcaaagaactttttcctccgggtgtgattggaccagacactgttctggtgttg
gcgaatgccatctactttaaggcaacttgggaacaccaatttgatccgagtcgtacaaca
gaaaaagactttaggctgaacgagaatgaaagtaagcctgtgcagatgatgcatcagaga
ggtcgatttcagttgggacatgtaggatcaataaatgcacagatcctttgtcttccatat
gttggtgaactgttgtccatgatcattttgctgccgaaagacatcagtgacctagagcag
gttgaaaacacaatgacttgtgagacgctggcagactggacttcacagcaaaatatgatg
gagcatcatgtggatgtatatataccccgtttcaaactcgaagacacctttgacctcaac
attactttgcaagcactggggatgaccgatgtgtttgatgaaagcaaggctgacctatca
ggcatgtccccctcgcagcaactgttcttgtccaaagttattcacaaagcctatgtggat
gttaatgaagtggggactgaagcagcagcggcaacaggtgcttctgtgtctacgagatcc
ttaatatcctatgaactctttttagctgatcacccattcctcttctgtatccgacataat
ccaacaaacactatacttttcctcggcaaattttgctctccttaa

DBGET integrated database retrieval system