KEGG   Anolis carolinensis (green anole): 100559237
Entry
100559237         CDS       T01608                                 

Gene name
sos1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04150  mTOR signaling pathway
acs04510  Focal adhesion
acs04540  Gap junction
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100559237 (sos1)
   04012 ErbB signaling pathway
    100559237 (sos1)
   04068 FoxO signaling pathway
    100559237 (sos1)
   04150 mTOR signaling pathway
    100559237 (sos1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100559237 (sos1)
   04540 Gap junction
    100559237 (sos1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100559237 (sos1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100559237 (sos1)
   04912 GnRH signaling pathway
    100559237 (sos1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:acs04990]
    100559237 (sos1)
Domain-containing proteins not elsewhere classified [BR:acs04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100559237 (sos1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19 PH_10 PH_13 Mcp5_PH
Other DBs
NCBI-GeneID: 100559237
NCBI-ProteinID: XP_003216158
Ensembl: ENSACAG00000006237
LinkDB
Position
1
AA seq 1329 aa
MQAPPLQYDFFSEENAPKWRGLLVPALKKVQMQVHPKLSSTEDALQYVEELILQLLNMLC
QAQPRSFQDVEDRVQKSFPHPIDKWAIADAQSAIEKRKRKNPLFLPVEKIHPLLKEVLGY
KVDHQVSLYIVAVLEYISADILKLVGNYVRNIRHDEITKQDIKVAMCADKVLMDMFHQDV
EDISTLTLSDEEPSTSGEQTYYDIVKSFMAEVRQYIRELNLIIKVFREPFITNPKLFSGH
DVENIFSRISDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYETYTQ
DILRTGFHDHFLSQLSKPGAAFYLQSIGDGFKEAVQYVLPRLLLVPVYHCLHYFEVLKQL
EEKSEDEEDKECLKQAITALLNLQSSMERICSKNLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFLMRKVQINDKDDTNEYKHAFEIILKDENSVIFAAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRFPSPELYRFAEPDSEENIVFEENMQPKSGIPI
IKAGTVVKLIERLTYHMYAGPNFVRTFLTTYRSFCKPQELLSLLQTSGIAEFEIPEPEPT
EADRIAMENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDVDLLQRLEE
FIGTVRGKAMKKWVESITKIIHRKKQAQAIGPSHNITFESSPPPVEWHISKPGHMDTFDL
LTLHPIEIARQLTLLESELYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFE
KCIVETENLEERVVVVCRIIEILQVFQELNNFNGVLEVVSAMNSAPIYRLDHTFEQIPSR
QKKIFEEAHELSEDHHKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEFLKRHGKELI
NFSKRRKVAEITGEIQQYQNQPYCLRIEPEIRKFFENLNPMGNSMEKEFADSLYNKSLQI
EPRNAKPPPRFPKKYNYPLKSPGIRPSNPRPGTMRHPTPLQQEPRKISYSRVPESETESA
ASAPNSPRTPLTPPPPSSMSSTTDVCSVFDSDPSTPFHSRSASVSSISFPKPSDEITVPP
PIPPRRRPESAPAESSPSKISSAHLDSPPAIPPRQPTSKMYSPRYSVTDRTSISDTPESP
PVLPPREPVRTPDVFSSSPLHLQPPPLGRKSELGNTFFPNSPSPFTPPPPQTPSPHVARR
HLPSPPLIPQDTDLHSVAGPPVPPRQSTSQHIPTVQHIPKLPPKTYKREPAHPSMHRDGP
PLLENAHST
NT seq 3990 nt   +upstreamnt  +downstreamnt
atgcaggcgccgccgctgcagtacgacttcttcagcgaggagaacgcgcccaagtggcgg
ggcctgctggtgcccgccttaaagaaggttcagatgcaagtccaccctaagctgtcatct
actgaagatgccttgcagtatgtcgaggaattaattctgcagttgctaaacatgctgtgc
caagcccaacccagaagctttcaggatgtagaggatcgtgtgcaaaagagttttccccat
cctattgacaagtgggcaatagctgatgctcagtctgcaattgaaaagaggaagcgaaaa
aatcctttatttcttccagtagaaaaaattcacccattattaaaagaagttctcggttat
aaagttgaccatcaagtatctctttacatagtagcagtattagaatacatttcagcagat
attttaaagttggttgggaactatgtaagaaatataagacatgatgaaattacgaaacaa
gacatcaaagtggcaatgtgtgctgataaggtattgatggatatgttccatcaggatgta
gaggatattagtacactaacattatctgatgaagaaccctccacatcaggagaacaaacg
tactatgatattgtgaaatcattcatggcagaagttcgacagtacataagggagctaaat
ctcataataaaagtattcagagaaccttttattaccaatccaaagctattttcaggtcat
gatgtagaaaatatattcagtcgcatatcagatattcatgaacttagtgtgaagctgttg
ggccatattgaagacactgtagaaatgacagatgaaggcagtccccatcctttagtagga
agctgttttgaagatttagctgaggaacttgcatttgatccttatgaaacctatactcaa
gatattttacggactggttttcatgaccactttcttagtcagttgtcaaagcctggggca
gcattctatttgcagtcaataggagatggttttaaagaagctgttcagtatgttttacca
aggttacttctagttcctgtttaccattgccttcactattttgaagttttaaagcaatta
gaagaaaagagtgaagacgaagaggacaaagagtgtttgaaacaagcaattacagccctg
cttaatcttcagagtagtatggaaaggatatgctccaaaaatcttgcaaagagaaggctt
agtgaatctgcgtgccgtttctatagtcaacaaatgaaagggaagcaacttgcaatcaag
aaaatgaacgaaatccaaaagaacattgacggctgggagggtaaagacattggacaatgc
tgcaatgaattcataatggaagggactctcacgcgtgtgggtgccaagcatgaaagacat
atatttctctttgatggcctaatgatttgttgtaagtcaaatcatgggcagccaagactg
cctggtgctagcaatgcggagtatcgtttgaaagaaaagtttctcatgcgaaaggtacaa
atcaacgataaagatgacactaatgaatacaagcacgcctttgaaataattttaaaagat
gagaacagtgttatttttgctgctaaatcagctgaagagaaaaacaactggatggcagcc
ttgatctctttacagtacagaagcaccttggaacgcatgttagatgtaaccatgttacaa
gaagagaaagaggaacagatgagatttccaagtcctgagctttacaggtttgcagaacct
gattctgaggagaatattgtttttgaagagaacatgcagccaaaatcgggaatccctata
atcaaggcaggaacagttgtcaaactgatcgagagacttacataccatatgtatgcaggt
cccaactttgttcgaacatttcttacaacatataggtcattttgcaaacctcaggaattg
ctgagtctcctgcaaacctcaggaattgctgagtttgaaattccagaacctgaaccaaca
gaagcagatcggatagctatggagaatggagatcaacctctcagtgcagagctcaaaagg
tttagaaaggaatatatacaacctgtacaactgcgagttttaaatgtatgccggcactgg
gtggagcatcacttctatgattttgagagagatgtagatcttttgcaacgtttggaagaa
ttcattggcactgtcagaggaaaagctatgaagaaatgggttgagtcaatcacaaagata
atccatagaaaaaagcaagcacaagccattgggccaagccacaatattacatttgaaagt
tctccgcctccagttgaatggcatataagcaagccaggacacatggatacatttgacctg
cttactttacatccaatagaaattgctcgacagctcactctacttgaatctgaactttac
agagctgtgcagccatcagagctagtgggaagtgtgtggacaaaagaagataaagaaatc
aattctcctaacctgctcaagatgataagacataccaccaatctgaccttgtggtttgaa
aaatgcattgttgaaactgaaaatctagaggaaagagttgttgtagtgtgccggataatt
gagatcttgcaagtttttcaagagttaaacaacttcaatggtgttcttgaggttgtcagt
gctatgaactctgcacctatttacaggctggatcacacatttgaacaaatcccaagccgc
cagaaaaagatatttgaagaagctcatgaactgagtgaagatcaccataagaaatactta
gcaaaactcaggtctattaatcctccttgtgtgcctttctttggtatttatttaacaaac
atcttgaaaacggaagaaggcaatcctgaatttctaaaacgacatggaaaagagctgatc
aattttagtaaacggaggaaggtggctgagataacaggggagatccaacagtaccaaaac
cagccatactgcctaagaatcgaacctgaaatcaggaaatttttcgaaaatttaaatcca
atgggaaatagcatggaaaaagaatttgcagattctctgtacaataagtccctacaaata
gagccacgtaatgcaaagccacccccaagatttcccaaaaaatataactatcctcttaaa
tctccgggtattcgtccatctaatccaaggccaggcaccatgcgacaccctactcctctg
caacaagagccgagaaaaatcagttacagccgtgttcctgagagtgaaacggagagtgcg
gcttccgcaccaaactctcccagaacccctctcaccccgccccctccctcctccatgtcc
agcaccacagacgtctgcagtgtctttgattctgatccctcaactccttttcattcaaga
tctgcctctgtatcctccataagctttcccaaaccctcagatgaaattactgttcctcca
cctattcctcctcgaagacgcccagaatctgcgcctgcggaatcctctccatcaaagatt
tcttctgcacacctggacagccccccagctatccctcctcggcagcccacctcaaaaatg
tattcaccgagatactcggtgacagaccggacgtccatctcagacaccccggagagcccg
cctgtcttaccaccccgagaacccgtgcggactcctgacgttttctctagttctcctctg
catctccagccacctcctttaggcaggaaaagcgaacttggcaacactttctttcccaac
agtccctctccgttcactccccctcctccccagacgccttctcctcacgtcgcacggagg
catttgccatcgcccccgttgataccacaagacacggaccttcattctgttgctgggccc
cctgtcccaccacggcagagcacctctcagcatatcccaactgttcaacatatcccaaag
ctgcctccaaaaacttacaaaagggagcctgcgcatccgtcaatgcaccgcgatgggccc
cccttgctggagaatgcccactccacctga

KEGG   Anolis carolinensis (green anole): 100563366
Entry
100563366         CDS       T01608                                 

Gene name
sos2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04150  mTOR signaling pathway
acs04510  Focal adhesion
acs04540  Gap junction
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100563366 (sos2)
   04012 ErbB signaling pathway
    100563366 (sos2)
   04068 FoxO signaling pathway
    100563366 (sos2)
   04150 mTOR signaling pathway
    100563366 (sos2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100563366 (sos2)
   04540 Gap junction
    100563366 (sos2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100563366 (sos2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100563366 (sos2)
   04912 GnRH signaling pathway
    100563366 (sos2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:acs04990]
    100563366 (sos2)
Domain-containing proteins not elsewhere classified [BR:acs04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100563366 (sos2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_10 IQ_SEC7_PH
Other DBs
NCBI-GeneID: 100563366
NCBI-ProteinID: XP_008120191
Ensembl: ENSACAG00000001355
LinkDB
Position
Un
AA seq 1334 aa
MQPPQPPPYEFLGEENGQKWRGLLVPALRKVQQQVHPNLSAKEDSLCYIEELIFQLLNKL
CVAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVEKIHPLLKEVLG
YKIDYQVSLYIVAVLEYISADILKLAGNYVFNIRHFEISQQDIKVSMCADKVLMDMFDQD
DIGLVSLCEEEPSSSGELNYYDLVRSEIADERQYLRELNLIIKVFREAFLSNRKLFTPND
IDMIFSNITDIHELTVKLLGLIEDTVEMTDESSPHPLVGSCFEDLAEEQAFDPYETLSQD
ILSPQYHEHFNHLMAKPAVALHFQSIADGFKEAVQYVLPRLMLVPVYHCLHYFEVLQQLQ
ECSEDEEDCECLKQAITALLNLQCSMERIYNKHSPRRRPGEPVFWFYTRQVRSKHLAIKK
MNEIQKNIDGWEGKDIGQCCNEFIMEGTLARVGAKHERHVFLFDGLMISCKANHGQSRLP
GYSNAEYRLKEKIVMRKVHIVDKDDTCEYRNAFELVPKDESSFIFAAKSAEEKNNWMAVL
ISLQYRSTLDRMLDAVLLQEENEQPLRLPSPSVYRFVVEDSEENIVFEDNLQSRNGIPLI
KGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADRL
AIEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHYYDFERDQELLDRLETFISTV
RGKSMKKWVESIAKIIRRKKQVHANGVSHNITFESPPPPIEWHISRQLETFDLLTLHPIE
IARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEMT
NFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAMNSVSVYRLDHTFEALQERKKKILDE
AVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRQGKGLINFSKRRK
VAEITGEIQQYQNQPYCLRVEPEIRRFFENLNPMGNIPEKEFTDYLFNKSQEIEPRNCKQ
PSRYPRKTTYSLKSPGIRPNAGRHGSTSGTLRGHPTPLEKEPYKISFSRITEAEQESAAS
APTSPVVPSTPPVSASSDVFLDNDLNSSYGSNNSIFAPVLLPQSKTFFSSCGSLHKLSEE
PLVPPPLPPRKKIDQDPSNSKGGSKSEEGPPAIPPRQPPPPKIQPRVPALSSGPLDQPLQ
SPPPPPPPPRDPLPDTPPPVPLRPPEHFVNCSFHLQQPPLGRFHRDPDRLREGGSCPGSP
STPPGTPSPRVLRRWCGLSPGASPGPPEPPPPPVPPRHNSSPQLPKLPPKTYKREFSHPP
LHRHSLLENAEAPQ
NT seq 4005 nt   +upstreamnt  +downstreamnt
atgcagccgccacagccgcccccctacgagttcctcggcgaggagaacgggcagaaatgg
cgggggctgctcgtgccggccctcaggaaggttcaacagcaggtccatcccaacctttca
gccaaggaggactccctctgctacatcgaggagctaatctttcagctgctaaacaaactg
tgtgttgcccagccaaggactgtccaagatgtcgaggagcgagttcaaaagacctttcct
cacccgattgacaagtgggccattgcagatgcacaatccgccattgagaagcgaaagaga
agaaaccctctcctgctgcctgtggaaaaaatacatccccttttaaaggaagttcttggc
tataaaatagattatcaggtgtccctttacatcgtggctgtcctggaatatatctctgct
gacatcttaaaactggctggcaattatgtgttcaatatacggcacttcgagatttcccaa
caggacattaaagtgtcaatgtgtgctgacaaggtgttgatggatatgtttgatcaggat
gacattggcttggtttctctctgcgaggaagagccctcttcttctggtgaactcaattac
tatgatcttgtccggagcgagattgctgatgaaaggcagtatctgcgagagctgaacctc
atcattaaagtatttcgagaagcatttctgtctaacaggaagttattcacgcctaatgac
attgacatgatttttagcaacatcacagatatccatgaactgacagtgaagctcttgggg
ttaattgaggacactgtggaaatgaccgatgaaagcagccctcacccactggttggcagc
tgttttgaggatcttgcagaggaacaggcctttgacccatatgaaaccttgtcccaggac
atcctttctccgcaatatcacgaacattttaatcacttgatggcaaaacctgctgtggct
ttacatttccagtcaattgctgatggctttaaagaagcagttcagtatgttctcccacgc
ctgatgttggttcccgtataccactgtttgcactactttgaagtattacagcaattacaa
gaatgtagtgaagacgaagaagattgcgagtgcctgaagcaagccatcacagcgctctta
aatctccagtgtagcatggaacgtatatacaacaaacactcacctagacgcaggccgggg
gagccagtgttttggttctacacccgccaagtccgaagcaagcacctggccattaaaaag
atgaatgagatccagaaaaacattgatgggtgggaaggcaaagacattggccagtgctgc
aacgaattcatcatggaggggacgctggccagagtcggggccaagcacgagcggcacgtc
ttcctctttgacggcttgatgattagctgcaaagccaaccacggccagtcgcgcctcccg
ggttacagcaacgcggaataccgactcaaggagaaaattgtcatgaggaaagtccacatc
gtagataaggacgatacgtgcgaatacaggaacgcttttgaactggtcccgaaggacgag
agcagcttcatctttgctgccaagtctgctgaagagaagaacaactggatggcggtgctg
atctccctccagtaccgcagcaccctggaccgcatgctggatgcagtgttgttgcaggag
gagaacgagcagcccctccggctgcccagccctagcgtctatcgctttgtggtggaagac
tccgaggagaacatcgtctttgaggacaacctccagagcaggaatgggatccccctgatc
aaaggcggcaccgtggtgaaactcattgagaggctcacctaccacatgtatgcagatcct
aattttgtacgtacctttcttaccacgtatcgctccttttgtaagcctcaagaactccta
agtttgttgatagaacgatttgagatcccagagcctgagcccacagaagctgatcggctg
gccattgagaaaggagagcagcccatcagcgcagaccttaagcgattccgcaaggaatac
gtccagccagtgcaactcaggatactcaatgtttttcggcactgggtggagcaccattat
tatgactttgaaagagaccaggagctcctcgataggctggaaacgtttatttccactgta
agaggcaaatccatgaagaagtgggtggaatccattgccaagatcatcaggaggaaaaag
caagtgcatgccaatggcgttagtcacaacatcaccttcgaaagccccccgccccccatc
gagtggcacatcagccgccagcttgaaacgtttgacctcttgacgctgcatcccatcgag
attgcgcggcaactgaccctcttggaatctgatctctaccgggctgtgcagccgtctgaa
cttgtggggagcgtgtggacaaaagaggataaggaaataaactctccaaatctactcaaa
atgattcggcacacaacaaatcttacgctttggtttgaaaagtgcattgtggaaatgaca
aactttgaagagcgagtggcggtgctaagtaggattatagaaatcttgcaagttttccaa
gacctgaataattttaatggtgtgttggagatagtcagtgcaatgaattctgtctctgtc
tacagattagatcacacgtttgaggcgctgcaggagaggaaaaagaagattctggacgaa
gcagtggaattaagccaagatcactttaaaaaataccttgctaagctcaaatcaatcaac
ccaccctgcgtgcctttctttggaatatacttaacaaatattctaaagaccgaagaaggt
aatcctgacttccttaagagacaagggaaaggattaatcaacttcagtaagagacggaaa
gtagcagaaatcacaggagaaatccagcaatatcagaaccagccttactgtttacgcgtc
gagccagagatccggcgtttttttgaaaacttgaaccccatgggaaacatccccgagaag
gagtttacggactacttgttcaacaaatcgcaggaaattgagcctcggaattgtaagcag
ccatctagatatcccaggaaaaccacctactccttgaagtctcccggaatcaggcccaac
gcgggccggcatggctccacctcgggcaccctgcggggccaccccacccctctggagaag
gagccctacaagatcagcttcagtcgaatcacggaagcggagcaggagtctgcggcctcg
gcccccacctccccagtcgtgccgtccactccgcccgtctctgcctcctcggacgtgttc
ctagacaatgacctcaacagctcttacggtagcaacaatagcatctttgctcctgtcctt
ctgccacaatcaaaaacgttcttcagttcatgcgggagtctgcataaactgagcgaagag
cctctggtgcctcctcctctgccgccgcgcaagaagatagatcaggatccttcaaactca
aagggcggctccaaatcggaagagggccctcccgccatcccgccgcgacagcctccccct
ccgaagatccagccccgcgtgccagcgctctcctccggcccgctggaccagcccctgcag
agcccccctccgccccctccccctccacgggaccccctccccgatactcctcctccggtg
cccctgcggcccccggagcactttgtgaactgctccttccacctgcagcagcctcccctg
gggcgcttccaccgggaccccgaccggctgcgggagggcggctcttgccccggctccccc
agcacgccgcccggcaccccctccccccgcgtcctgcgccgctggtgtgggctcagcccg
ggcgccagccccggccccccggagcccccgccgccccccgtcccgccgcgccacaactcc
agcccccagctccccaaactgccgccaaagacttacaagagagagttttcccaccctcct
ttgcacagacactctttgctagagaacgcggaggcgcctcaatga

DBGET integrated database retrieval system