KEGG   Anolis carolinensis (green anole): 100559621Help
Entry
100559621         CDS       T01608                                 

Gene name
setd2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100559621 (setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acs03036]
    100559621 (setd2)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100559621 (setd2)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100559621 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 100559621
NCBI-ProteinID: XP_008121681
Ensembl: ENSACAG00000002296
LinkDB All DBs
Position
Un
AA seq 2648 aa AA seqDB search
MKKRPKMGDFYDPEHPTLDTTFMSKDPSGHHNPNTSSIPEMHSPLRWKGADNWCIFPQNM
DGSEEVEREEENEGKGDNLQKPGFVKGPVFKGIASSRFLPKGTRTKVNLEEQGRQKVSFS
FSLTKKTLPNRFLAGLGNDKQNETSGSPAAAPPTDLASKIKMDLVDSPSAVEEFSPPKPK
VELGRIHFKKHLLNVTTKLPLAVAAALPPPPPPPPPPALQAPADAFEMVELPPSPPPPPP
PPPPPPPPQMVSTPATVLTPPALSQIPSTPVPPLPPSPVETIVQMTKVPSLKTSQETSEA
DVQENSSVLNVSIEHLPEAVSDEAEPTPTKGHSHNGKEEEVSDGSKVAPQSSKKQGSRRK
FSLSDVPAPGSESDEDSVRTSSSQRSHDIKLPTSSEKEKDSRKSSSSHKTEAPSKTSSRS
KSDRDEKYSSYSRSERDSRYSSSRSRADRERRRSRSRSRSRSERSSRPSSSYSRSERSHY
YDSDRRHHRSSPYREKSRYSRSYTDSRTRESSDSEEEYRRSYSSRSTDSRRTSSHSSSYR
DSRTSSSYSKSERESRTESSHTESDRKGKSTKSERESRRTSETDGSRRCSPTGESRHRSG
ASHSKADSSVTSSRHKPTSSKTSVPRPDKFKSSFCCTESEEVKEQSNCIDSEASCVQSCE
IKTAVPPKPETDRTVSPLSPLRDSPSFKKLEESKEGSPISKSNELAGIDSHDSIKEVDSF
VTVKHDITLTTCSTRTETNLNGSPESTQNDTAVFCNSEPEVTVSSDNSLDRSDSLDTFEA
QSQIKSPHLNKTPSNGVQSVSPSKEQALGDSLLLSSESICLPIKKEEVLILSEYECVPSC
TENVNLSEITQNVDDQTDPCNQAKDPVPCYLSDDATPLYYSEVEIEAEPSDAKAAPGSFT
DVNVEPCIETLKSSDVEDQNSLGCAHEGEKCLKQFNSIESSPARDSSMEESLVNMELDNQ
CVAEQQQQTCENGSLELETTLQEKEEEVLECSEVALELDVLQVESAIEKTTSPLKNEHSY
YLERSIQDPEKEEPNGDEDSLALDERATSGLDDCSPEVFVMKDESSVVESDFPGALSPCD
ILVAEEETETVPEVTRCDSSRSNPELTPVHNEDYSDLAESGSEQGSDESDTEDSDSDDSS
IPRNRLQSVVVIPKNSTIAMEESSSCSSRNSQSNRRYLDRWEEARPESSKSFYEDAPNDL
EAGHALQNERKCLSSRDMEGNLAISAEPSRMEMADLQPRISQPQSDDVDSTSQSDQASDS
IGKPNPEERVALSETMSLARFVGESQEHELHYFPRNFEMTDHMSRLQTSISKPDSQQGKP
CFGDLPGPGGLSREDGFHSTEEWDFSQAEKPSSTYQQPDSSYGIYPGYVYPPNSGPYVGS
HSYWHDNGYWDPRLTHRPCEMNYERMQGPVPDSLTEDHEEYEEVDHWVDEGQAYFPSQSV
KYPSRDPREKGSVQAHEISSNSVKEPVAASEQKEQASKALDRNDMKERGPLKKRRTDLES
ESESDGDSQERKKAKTEGEPLPAVPQGDSLGEGLLCYMEDFRDPQRWKEFAKHGRMPCYF
DLIEENVYLTERKKNKSHRDIKRMLCECPTLSKDERAQGEVACGEDCLNRLLMIECSSRC
PNGEHCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKTRV
KEYARSKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTT
KMVPSGSELTFDYQFQRYGKEAQKCFCGSTNCRGYLGGENRVSIRAAGGKMKKERSRKKD
SVDGELEALLENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQACLKTFLES
HGLSLLWIWMTELGDGRGNTANNLKLKLEIIKTLELLPIPNKNMLEESKVLPIIQRWAQT
KLAIPHLSEGDGYSSENTSRAHTPLNTPDPSAKPSTEVEADTPKKLAFRRLKIISENSMD
SAASDTISEVELKDGKEEPPEHLDSAPMETVAEEEPVQAEDVVKDAAPEAPADPNQPQAA
EQEPEPEVEMKEIIIAAKMEEPVAGETPSQDEEEGLSDVESERSQEQTDKIVDVSDLATR
LLDCWKDLKEVYRIPKKSQVEKETTADRGRETAGRDPASTPKNLSRERDPERQSQSKEKK
KRRDSLSPPSAYERGTKRPDDRYDTPAASSKKKVRIKDRNKLSTEERRKLFEQEVAQREA
QKQQQQLQSLGMASPLPYDPLGYSAAHHAFMGYPPGYPMQSYVDPSNPNAGKVLLPTPSL
DPMCSPAAYDHSQTLVGHPIETTLAAPQPVPVVQHVAAALEVPAPQYVAQGDSVVHQDTS
GVTVLPVSAPVQGQSYGVWDSGQQTVAVQPPYSPAQTQPAIYYQGQACQAVYGVTSPYSQ
TASPIVQSYAQPGLQYIQGQQIYTAQGVVVQPTTAVTTIVAAGQPPPIQQPELVVTNNLL
DLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVATRQTQWDPPNWDSPEDDASLEHEAE
MDLGTPTYDENPMKSSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKV
GRINTTEDFKHLARKLTHGVMNKELKYCKTPEDLECNENVKHKTKEYIKKYMQKFGAVYK
PKEDTDLE
NT seq 7947 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaggccgaaaatgggggatttctatgaccccgaacatcccaccctcgacaca
actttcatgtcgaaggaccccagtggacatcataaccctaatacctccagcatccccgaa
atgcactcacctctgaggtggaaaggggcagacaactggtgtatctttccccagaatatg
gatgggtctgaagaggtagaaagagaagaagaaaatgagggcaagggtgacaacctgcag
aagcccggtttcgtcaaagggccggtgttcaagggaattgcctccagccgtttcttgccc
aaagggacccggacaaaagtgaacctggaggaacaaggcagacagaaggtgtccttcagc
ttcagcctcaccaagaagaccttgccaaacagatttctggcaggacttgggaatgataag
caaaatgagacgtcgggttccccggcggcagcccctccgaccgatttggcttccaaaatc
aaaatggacttagtggactcacccagtgcggtggaggagttctcaccaccgaagcctaag
gtggaattaggcaggattcattttaagaaacatttgctgaacgttacaacaaagcttcct
ttagcagttgctgcggcgcttcctccacctccgccacctcctccgcctccagcacttcaa
gctccagcggatgcatttgaaatggtggaattgcccccatcaccccctcctcctccccct
cctccaccacctcctccccctccacaaatggtgtccacaccagcaacagtgctaacccca
ccagctttgtcacaaatcccgtcaacgccagtcccccctctgccaccatcgcctgtagaa
accattgtgcagatgacaaaagtgccctcgctgaaaacatcacaggagacttcagaagca
gatgttcaagaaaattcttctgtcttgaatgtttccatagagcatcttcctgaagccgtt
tccgacgaagcagaaccaaccccgacaaaaggacattcccacaatgggaaggaggaagaa
gtttccgatggctcaaaagttgctcctcaaagttctaagaagcaaggctccaggaggaag
ttctcgctgtctgatgtcccagccccgggttccgaatctgacgaagattctgtaagaacc
tcttccagccagagatcccatgacattaaattgcccaccagctcggagaaagaaaaggat
tcgcgaaagagctcttcttctcacaaaacggaagcgccgtcaaaaacctcctcacgctct
aaatctgaccgagatgaaaagtattccagctattctcgatccgagagagactcaaggtac
tcttccagtcgttccagagctgaccgagagaggaggcgaagtagatctcgttcccgttct
aggtcagagagaagttctagacccagttcctcctattccagatcggagcggtcacattac
tatgactcggaccgaaggcaccacagaagctcaccctacagagagaagagccgatactct
cgttcctacacagatagcagaaccagagagagttccgattcagaagaagaataccgaaga
tcatactctagtagatctacagactcgcggcgtacctcctctcattcctcatcctacaga
gactctaggacctcttcctcttattcaaagtccgaacgggaaagtaggactgaatcttct
catactgagtcagatagaaaaggaaagtctacaaaatcggaaagagaatcaagaaggact
tcagaaactgacggttccagaaggtgttctcctaccggagagtcgcgacatcgaagtgga
gcatcccattctaaagctgacagcagtgtgacttcttcccgacacaagcccacctcttcg
aagacatctgttccaagaccagataaatttaaaagttctttctgttgtacagaatctgag
gaagtcaaagagcagtctaattgtatagactcggaggcatcttgtgttcaaagctgtgaa
ataaaaactgctgtcccaccgaagccagaaacagacaggactgtttccccattaagtccg
ttacgtgattcgccttcttttaaaaagctagaagaatcaaaagaaggttctcctatttct
aagtcaaatgaacttgcaggaattgatagccatgacagtattaaggaagtggactctttt
gtcacggtaaaacatgatattacgctaacaacttgttctacaagaacagaaactaattta
aacggatccccggaaagtacacaaaacgacactgcagtgttctgtaattctgaaccggag
gtcacagtatcttctgataatagtctagatagatctgatagtttagatacgtttgaggca
caatctcaaatcaaaagccctcatttgaacaagacaccatctaacggggttcaaagtgtg
tctccttctaaagaacaggccctgggcgattccctgctcctttcaagtgaatccatctgt
ttgcctatcaaaaaggaagaagttttaattctttctgaatatgaatgtgtcccttcctgt
actgagaatgtaaatctttctgaaattacacaaaacgtggacgatcaaacagatccctgt
aatcaagccaaagatccagtcccttgttacctttcagacgatgccactcctttgtattat
tccgaagtggaaattgaagctgagccttcagatgcaaaagctgctccaggatctttcacg
gacgtaaatgtagagccatgcattgaaacattgaaatcttcagatgtagaggaccaaaat
tcattgggctgtgcacatgaaggtgaaaaatgtttgaaacagttcaattcaatagagagt
agcccagccagagattcttccatggaagaatcccttgtgaacatggaattagacaatcaa
tgtgttgcagagcagcagcagcaaacgtgtgaaaacgggtccttggagttagaaacaacc
ttgcaggagaaggaggaggaagtcttggagtgttctgaagtagcacttgaactagatgtc
ctgcaggttgagtccgccattgaaaagacaacatcgcctttaaaaaacgagcattcgtat
tatttagagagatcgatacaagacccagagaaagaagaacccaacggagatgaagactcc
cttgccctggacgaaagagccacatctgggttggacgactgctctcctgaagtctttgtg
atgaaggacgaaagctcagtggtggaatcggactttccaggcgccctctccccttgtgat
attcttgttgccgaagaagaaacagaaactgtacccgaagtgaccaggtgtgacagtagc
cgcagcaatcctgaactcacgcctgtgcacaacgaagactattcggatctggctgaaagc
gggagtgagcaaggtagcgatgaaagcgacacggaggactctgattcagacgacagcagc
attccaaggaatcgccttcagtcggtggtggtcattccaaagaactcaacgatagcgatg
gaggagagcagctcttgttcctcacggaacagtcagagcaacaggcgctatttggaccgc
tgggaagaggcacgaccggagtccagcaagtccttctatgaggatgcaccaaatgacctg
gaagccggtcacgctctgcaaaatgagaggaagtgtctctcttcaagagacatggagggg
aacctagcaatatctgctgagcctagcagaatggagatggcagaccttcagcccaggatc
tcccagcctcagagtgatgacgtggacagcaccagtcagtccgatcaagcgtcagattcc
attggcaagccaaatccagaagaaagggtggcattgagcgaaacaatgtctctagctcga
ttcgttggcgaatcccaagaacacgaactgcattactttccaaggaactttgaaatgact
gaccatatgtctaggttgcaaaccagtatttcaaagccagacagccagcagggaaagcct
tgtttcggggacctccctggtcccggaggcctctctcgagaagatggtttccattcgaca
gaggagtgggacttctcccaggcagagaagcccagtagtacttaccaacagcctgacagt
agctatggcatctaccctggttatgtgtacccaccaaactcaggaccttatgttgggtct
cacagttactggcacgataacggctactgggacccaagactgacccacaggccctgtgag
atgaattacgagcggatgcaagggccggtcccagactccctcacggaagatcatgaagag
tatgaagaagtggaccactgggtggatgaaggccaagcctacttccccagccagtcggtg
aagtacccgtcccgtgacccgagggagaagggatcggtgcaggcccacgagatcagcagc
aactcggtgaaggagcctgtagccgcgagcgaacaaaaagagcaggccagtaaggctttg
gacagaaatgacatgaaggagcgaggaccactgaagaagaggcggacggatttggagagc
gagtcggagagcgacggggactcccaggagcggaagaaggccaaaacggagggcgagcca
ctgcccgctgtgcctcagggggactctttgggggagggcctgctgtgttacatggaggac
ttcagagacccccagcggtggaaagagtttgccaagcacgggaggatgccctgttacttc
gacctcattgaagaaaacgtgtatctgaccgaaaggaagaagaataagtcgcaccgtgac
atcaagcggatgctgtgcgagtgtcccacgctttccaaagacgagagggctcaaggagag
gtggcctgcggagaagactgtctaaatcgtctgctcatgatagaatgctcttcgagatgc
cccaacggggagcattgctccaaccgccggttccagaggaagcagcatgcggacgtggaa
gtcatcctcacggagaagaaaggctggggcctgagagcagcaaaagacctgccctctaac
acctttgtcctggagtattgtggtgaagtgctggatcacaaagagttcaagacccgagtg
aaggagtacgcccggagcaagaacatccattactattttatggccttgaagaacgatgag
atcatagatgccacccagaaaggaaactgctctcgtttcatgaaccacagctgtgagcca
aactgtgagacgcagaagtggacagtgaatgggcagctgcgagtcggctttttcaccacc
aagatggttccttcaggttcagagctgacttttgactaccagttccagcgatatggcaaa
gaggcacagaagtgcttctgtggctccaccaactgccggggataccttgggggcgagaat
cgggtcagcatcagagcagccggcggcaaaatgaagaaggagcggtcgcgaaagaaggat
tcggtggatggagaattagaggcactcctagagaacggagaagggctttcagacaagaac
caggttctcagtttgtctcggctgatggtacgcattgagacgctggagcaaaaacttacc
tgtctcaaactcatccagaatactcattctcaagcctgcctgaagaccttcttggaaagt
catggcttgtcgctcctctggatttggatgacggagcttggggacggacgggggaacacc
gccaacaacctgaagctcaagctagagattataaaaaccctggagctcttgccgatcccc
aacaagaacatgctggaggagagcaaagtgctcccgatcatccagcgctgggcccagacc
aagttggccatcccgcacctcagcgaaggggacggctactccagcgagaacacctcgcgg
gcccacacgccgctcaacaccccggacccttccgccaagcccagcaccgaggtggaggcg
gacacgcccaagaagctggccttccggaggctcaagatcatcagcgagaacagcatggac
agtgccgcctcggatacgatcagtgaggtcgagctgaaggatggcaaggaggaaccaccg
gagcacttggacagcgcaccgatggagactgtggcagaggaggaacccgtgcaggcagag
gatgtggtcaaggatgcagctcctgaggccccggcggaccccaaccagcctcaggcggcg
gagcaggagcccgagccagaggtcgagatgaaggagatcataatcgccgcaaagatggag
gaacccgtggccggggaaacaccttcccaagacgaagaggagggcttgtcagacgtggag
agcgagaggagtcaggagcagacggataagatcgtggatgtgagcgatttggccacccgg
ctcctagactgctggaaagacctaaaagaggtttaccggatcccgaagaagagtcaagtg
gaaaaggagaccaccgcagatcgtgggcgagagacggcaggaagagaccctgcttcgacc
ccgaaaaacctgagcagagaacgagaccctgaaaggcaaagtcagagcaaggaaaagaag
aaacgccgggattctttgtctcctccttcagcgtatgaacgaggcacaaagcgaccggat
gacaggtacgacacgccagccgccagctccaagaagaaagtccggatcaaggaccgcaac
aagctctccacggaagagcggcggaagctctttgagcaggaggtggcgcagcgcgaggcc
cagaagcagcagcagcagctgcagagcctgggcatggcctccccgctcccctacgacccc
ttgggctacagcgccgcccaccacgccttcatgggctacccgcccggctaccccatgcaa
tcctacgtggaccccagcaaccccaacgcggggaaggtgctcctccccacgcccagcctg
gaccccatgtgctccccggcggcctacgatcactcccagactctggtggggcaccccatc
gaaaccaccctggccgccccgcagcccgtgcccgtcgtccagcatgtagcagcggccctg
gaggtccccgccccgcagtacgtggcccagggcgactccgtcgtccaccaggacacgagc
ggcgtcacggtcttgccagtctcagcccccgtgcaaggacagagctatggcgtctgggat
tccggccagcagaccgtggccgtgcagcccccctattccccggctcagacgcagcccgcc
atatactaccaagggcaagcgtgtcaggccgtttatggggtgacgtcaccgtattcgcag
accgcgtcaccgattgtacagagttacgcacaaccaggccttcaatacatccaggggcag
cagatttacacggcgcagggggtggtggtacagcccacgacagccgtgaccactattgta
gcagctgggcagcctccgcctatacaacagccggagcttgtggtgaccaacaaccttctg
gacctgcctccgccgtctcccccgaaacccaaaaccattgtcctccctcccaattggaaa
acggcccgagaccccgagggcaagatctattattaccacgtggccacaaggcaaacccag
tgggaccctccaaactgggacagccccgaagatgacgccagcctcgaacacgaggccgaa
atggacctcgggactccgacctacgatgaaaaccccatgaagtcttccaaaaaacccaaa
acagcggaagcggacacttctagcgaactggcaaaaaagagcaaggaagtcttccggaag
gagatgtcacagttcattgtccaatgcctgaacccttatcgcaagccggattgcaaagtc
ggacggataaacacaacggaagacttcaagcatcttgcacgaaagttaacccacggagtc
atgaacaaggagctgaaatactgcaagacccccgaggacctggagtgcaacgagaacgtg
aagcacaagacgaaggagtacatcaagaagtacatgcagaagtttggggccgtttacaag
cccaaagaagacaccgatttggagtag

DBGET integrated database retrieval system