KEGG   Anolis carolinensis (green anole): 100559769
Entry
100559769         CDS       T01608                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 26
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04060  Cytokine-cytokine receptor interaction
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs04217  Necroptosis
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100559769
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100559769
   04217 Necroptosis
    100559769
   04115 p53 signaling pathway
    100559769
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100559769
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:acs04050]
    100559769
   04090 CD molecules [BR:acs04090]
    100559769
Cytokine receptors [BR:acs04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100559769
CD molecules [BR:acs04090]
 Proteins
  100559769
SSDB
Motif
Pfam: TNFR_c6 Death DUF4366
Other DBs
NCBI-GeneID: 100559769
NCBI-ProteinID: XP_016848761
Ensembl: ENSACAG00000029485
UniProt: R4G9M7
LinkDB
Position
1
AA seq 340 aa
MCRAGTYVEEACTIPHTLGRCSPCTNGEDYTEHESGLNQCFPCEKCKPGYVMVKACTATS
NTKCQCPEGYYCPPGCEECVKCRKRCPKGEVQVKSCSSTTDMECSPSSTGTTDSAHPMGI
IITVVFSVIGIGIVIMIAILFKFRKRNSLSTLERVKESKSLISVNSDAPNTNPEMPGLRN
KGSQNEESSNLMVGSTSEGSDPRKAPSAPMLQQSENPAFPSVPPNIPKKPVVKLIDGYSK
TELNRIYFNLRNMVLLHDWSELMRKCGLTNNDIETLKFDHPRDINEAHYQMLLTLQNRKG
IDGALCKLLDGLWELKLMSIYENVTNELIHHKIITRETRD
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtgccgtgcaggtacttacgttgaagaagcctgtaccattccacatactttggggcgc
tgttcaccttgcacaaacggagaggattacactgagcatgaaagtggccttaatcaatgt
tttccttgtgagaaatgcaaacctggatacgtcatggtgaaagcctgcactgctacaagc
aacacaaaatgccagtgccctgaagggtactactgtcccccaggctgtgaggaatgtgtc
aagtgcaggaaacggtgtcctaaaggagaggtgcaggtcaaaagttgcagtagcaccaca
gacatggagtgttcaccatcttccacaggaactacagactctgcacacccaatgggtatc
atcattactgtggtcttcagtgtgatcgggattgggatcgtgatcatgatcgccatcctc
ttcaaatttagaaagagaaactcactctctacactggaaagagtaaaggaatccaagtct
ttgatatctgtaaatagtgatgctccaaacactaatcctgagatgcctggactgagaaat
aagggatcccagaatgaggagagcagcaatttgatggttggcagcacaagtgaaggatct
gaccctagaaaagccccatcagctccaatgctgcagcagtcagagaaccctgcctttcca
agtgtgccaccaaacatacctaaaaaacctgtggtgaaactaatagatggttattcaaaa
acagaactcaacaggatttattttaacttgaggaacatggtacttctacacgactggtct
gaacttatgaggaagtgtggcttaactaataacgacattgaaaccttaaagtttgaccat
cctcgtgatataaacgaagcacattatcagatgttattaactttacagaatcgaaaggga
attgatggtgctttatgtaaattattagatgggctgtgggaattgaagcttatgagtatt
tatgaaaatgtaacaaatgaattaatacaccataaaataataacaagggaaaccagagac
tga

KEGG   Anolis carolinensis (green anole): 103281217
Entry
103281217         CDS       T01608                                 

Gene name
tnfrsf10b
Definition
(RefSeq) TNF receptor superfamily member 10b
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04060  Cytokine-cytokine receptor interaction
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs04217  Necroptosis
acs05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103281217 (tnfrsf10b)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103281217 (tnfrsf10b)
   04217 Necroptosis
    103281217 (tnfrsf10b)
   04115 p53 signaling pathway
    103281217 (tnfrsf10b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103281217 (tnfrsf10b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:acs04050]
    103281217 (tnfrsf10b)
   04090 CD molecules [BR:acs04090]
    103281217 (tnfrsf10b)
Cytokine receptors [BR:acs04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103281217 (tnfrsf10b)
CD molecules [BR:acs04090]
 Proteins
  103281217 (tnfrsf10b)
SSDB
Motif
Pfam: TNFR_c6 Death DUF2227
Other DBs
NCBI-GeneID: 103281217
NCBI-ProteinID: XP_008120544
LinkDB
Position
Un
AA seq 390 aa
NDSSFPCLFYQHEVAGVAIIWNSKDPPRATLGEAEDPSEFYLHEGHKCRKCSPGYRVNRH
CTSDTETTCQPCNKDTYSKHLNPLLKCFSCKTCRPLDEVELQPCTTTSDTECACKNGTFC
LPSFPCETCHKCTPRCPEGEQMVQPCTPISNIVCAPYTTSPPPPTGGSHGVIVGTLLGLL
LLVLVVAGISWKRGCCNGAKARRVTAVLWRSKTLQCLQRNCSQGHHEEVDNLRNMHCESQ
PPLQTCAHPSPRSLEATPLQAADPPEEESHVCAAEGRRNLIPVNGKDPIEALRESFYTFI
KEVPPKDWLRYMRTLGLGEIDIYAAEQSSKNLYEQHFQMLQTWLNQRGKDASLETLLETL
RSIDLKGVEDKVRECLIKKNLYVYEDSVLP
NT seq 1173 nt   +upstreamnt  +downstreamnt
aatgactcctcctttccttgtctattttatcagcatgaagtcgcaggcgttgctattata
tggaactcaaaggaccctcctcgtgccaccttgggagaggctgaagacccaagcgagttc
tacttgcatgaaggacacaaatgcaggaaatgttctccaggttatcgagtcaaccgacac
tgtacttcggataccgaaacgacttgccaaccctgtaataaggatacatatagcaaacac
ttgaatccactgttaaagtgcttttcttgtaaaacctgccgacctttagatgaggtggag
ctacagccgtgcaccacaaccagtgacaccgaatgcgcctgtaagaatggcaccttctgc
ttgcccagttttccgtgtgaaacatgccataagtgcacacccagatgccccgaaggagaa
cagatggtgcagccttgtacccctataagcaacatagtgtgtgcgccctatacaacctct
ccacctcctccaacaggaggttcccatggagtcattgtggggactttgcttggtcttctt
ctgttggtgttagtggtggcaggaatatcctggaagcgtggttgctgtaacggagccaaa
gcgaggagagttacagcagtcttgtggcgttccaagactctccagtgtctccagaggaat
tgcagtcaagggcaccatgaagaggtggacaacctgcggaacatgcactgtgaatcccag
ccccctttgcagacttgtgcccatccctctccaagatcacttgaagcgacacctctgcag
gcagctgacccaccagaagaggaatcccatgtatgtgcagcagaagggaggaggaatctc
attcctgtaaatgggaaagaccctatagaggctttgcgggagtctttttacacctttatt
aaagaggtccctccgaaggattggctcagatacatgagaacccttggcctgggagagatt
gacatttatgcggctgagcagagcagtaagaatttatacgagcagcacttccagatgctc
cagacctggctgaaccaaagaggaaaggatgcgtctttggagactttgctggagacgctg
agaagcattgacctcaaaggtgtagaggacaaagtgagagagtgcctgatcaaaaaaaac
ctctatgtttatgaggattcagttcttccgtaa

DBGET integrated database retrieval system