KEGG   Anolis carolinensis (green anole): 100559825Help
Entry
100559825         CDS       T01608                                 

Gene name
ganc
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00052  Galactose metabolism
acs00500  Starch and sucrose metabolism
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100559825 (ganc)
   00500 Starch and sucrose metabolism
    100559825 (ganc)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100559825 (ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 100559825
NCBI-ProteinID: XP_008102393
Ensembl: ENSACAG00000015340
LinkDB All DBs
Position
1
AA seq 916 aa AA seqDB search
MASGSQETVSVQDEAVEESQFKTCRQIAFYRRQKHLGPGKPLYRVLPDTVELSNSNVRFQ
IISEEYKDPLLVEVYEIEGNIFRLKINEITPLKPRYEVPDVLIKEPSSLRLTILEKDADK
LVLACASKDQQLHITINPFQIQFVSKDEMVLSINSNDLLYFEQLQPPPQTRTSMLQEKKD
GSTNYSKKDQDDLGLWEEKFGNFLDIKANGPSSIGLDFSLHGFQHVYGIPQHAETLLLKN
TSNEDVYRLYNLDVFGYRIHSKMGIYGSVPLLLAHKPDRTIGVFWLNSSETLVEITTKAA
MKVLPSQIPDVSKQRVLPQTDVCWMSESGIIDSFILMGPSPFDIFKQYAQLTGTQALPPL
FSLGYHQCRWNYVDEKDVEGVDTGFDVFNIPYDVMWLDIEHTDGKRYFTWDKETFGNPKR
MQKKILMKKKRKLVVILDPHIKVDPLYTIYSQGKERGYFVKDRKGGDFEGICWPGSSSYL
DFTNPKVRDWYAELFAFKTYKGSTEILFAWNDMNEPSVFRGAELTMQKDAVHYGNWEHRE
VHNLYGFYQQMATAEGLIRRSGNLERPFVLTRSFFAGSQRYGAVWTGDNKAEWSYLKISI
PMLLTLSIAGISFCGADVGGFVGDPEPELFVRWYQAGALQPFFRGHANMHTKRREPWLFG
EKNTQIIRAAIKERYSLLPYLYSLFYQAHTTAEPVMRPIWVEFPKQLEAFGIEDEYMLGK
ALLVHPVTEPKVTTVSILLPGSEEQIWYDFRKFSCLKTQGILKIPVTLDNIPVIQRGGTI
IPLKTSVGKSTEWMVDVPYELRAALDSKESAAGELYLDDGHSFQYLHEKQFLLRKFTFYQ
NVFSSRHADGDPRYHTKCKVEQITILGMKKQPSTVTASIHGGKNKKVAFTYDAKNSVLIL
QKLSLHVGKDWELHIQ
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaggaagccaggaaacagtcagtgtccaggatgaggccgtggaggaaagccag
tttaagacatgcagacagattgccttctacaggaggcagaaacatttgggtcctgggaag
cccttgtaccgggtcttgccagacacagtagaattatccaacagcaatgtcagattccaa
attatcagtgaagaatacaaggatccccttttagtagaagtttatgaaatagaaggcaac
attttcagacttaaaattaatgagataacacccctgaaaccaagatatgaagtccctgat
gttcttataaaagaaccatccagcctcaggctaactatattagagaaagatgcagacaag
cttgtgttggcctgtgccagtaaagaccaacagcttcacataacaataaatcctttccag
atacaatttgtttcgaaagatgaaatggttctgagcatcaactcaaacgacctattatat
tttgagcagttacagccaccgccccaaaccaggacatcaatgctgcaagaaaagaaagat
ggatccacaaattattctaagaaagatcaggatgacctaggtctctgggaagagaaattt
ggcaactttttagacatcaaagcaaatggtcccagcagcataggcttagatttttcttta
catggatttcaacatgtctatggaatacctcagcatgcagaaacacttctccttaaaaat
accagcaatgaggatgtctaccgactttacaacctggatgtctttggatacaggatccac
agtaaaatgggtatctatggttcagtgcccttgctcttagcacacaaacctgacagaacg
attggggtattttggctgaattcctctgaaactttagtagagattacgactaaagctgca
atgaaggttttgccttcccaaattccagatgtctcaaagcaaagggtgttgcctcaaacc
gatgtgtgctggatgtcagaaagtggaataatagattctttcatcctaatggggcccagc
ccttttgatatttttaagcagtatgcacagttgacaggtactcaagccctgcctccactt
ttctcccttggttaccaccagtgccgctggaattatgtagatgagaaagatgtagaaggg
gttgatacaggttttgatgtattcaacatcccctacgacgttatgtggctagacattgag
catactgatggaaagcggtacttcacgtgggataaggagacatttggtaaccctaagagg
atgcaaaaaaagatactcatgaagaaaaaacgcaagcttgttgtcattctggacccgcat
attaaagtcgatcctttgtacaccatatactcacaaggaaaagaaagaggatattttgta
aaagaccgtaaaggtggggattttgaaggcatctgttggccaggttcctcttcttacttg
gatttcaccaatcctaaagtcagagactggtatgcagagctgtttgcattcaaaacatac
aagggttccactgaaatcctttttgcttggaatgatatgaatgagccctcagtcttcaga
ggggcagaactaaccatgcagaaggatgctgtccattatgggaattgggaacatcgagag
gttcataatctctacggtttttatcagcaaatggcaacggcagaaggattaatcagacgg
agtgggaatttggagaggccatttgttcttacacgttcttttttcgctggatcacagaga
tatggtgcagtatggactggagacaacaaagcagagtggagctacttgaaaatctccatt
cctatgttgctcacacttagcattgcagggatttctttctgtggagcggatgttggtgga
tttgttggagacccagaaccagagctatttgttcgatggtatcaagctggagcactccag
cctttctttagaggccatgctaatatgcacaccaagcgccgtgagccctggctgtttggt
gaaaagaatacacagatcatcagggcggctatcaaggagcgctattcccttcttccttat
ttatattcactcttctaccaagcacataccactgcggaaccagtcatgagacctatctgg
gtagaattccccaaacaactagaagcttttggcattgaagatgagtatatgcttggaaag
gctttgttggtgcatccagtcactgaacccaaagtcacaacagtcagtatccttctgcct
ggttcagaagagcagatctggtacgactttcgaaaatttagttgtttgaaaactcaaggc
atattgaagattccagtgacattggacaatattccagtcattcagcgtgggggcactatt
ataccattaaaaacctctgtaggaaaatccacagaatggatggtagatgttccttatgaa
cttcgtgctgctctggatagtaaggagtctgcagctggggagctctatctagacgatggc
cattcatttcagtatcttcatgagaagcagttcttgctgaggaaattcaccttctatcag
aacgtcttctcatctagacatgcagatggagacccaaggtatcacacaaaatgcaaagtt
gagcagataacgattttgggaatgaaaaagcaaccttctactgtaacagccagtattcat
ggtggaaaaaacaaaaaagtggctttcacatatgatgccaagaactcagtgttgatcctt
caaaagctttcattacatgttggcaaagattgggagctgcatatccaatga

DBGET integrated database retrieval system