KEGG   Anolis carolinensis (green anole): 100559887
Entry
100559887         CDS       T01608                                 

Definition
(RefSeq) cytochrome c iso-1/iso-2
  KO
K08738  cytochrome c
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100559887
   04115 p53 signaling pathway
    100559887
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100559887
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100559887
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 100559887
NCBI-ProteinID: XP_003226812
Ensembl: ENSACAG00000029156
UniProt: R4GAF7
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFVQKCSQCHTVEKGGKHKTGPNLWGLFGRKTGQSAGFSYSDSNKNKGIVW
SETTLMEYLEDPKKYIPGTKMIFAGIKKKNERADLIAYLKKACSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgaaaaaggtaaaaagatatttgttcaaaaatgttcgcagtgccacacg
gttgaaaaaggtggaaagcacaagacggggccaaatctttggggactctttggccgtaaa
acaggacaatctgccggattttcttactccgattcaaacaagaataaaggtattgtctgg
agtgaaactacattaatggaatatttggaggacccaaagaaatacattcctggaacaaaa
atgatttttgctggcattaaaaagaagaacgagagagcagatctcattgcatacttgaaa
aaagcatgctcttcatga

KEGG   Anolis carolinensis (green anole): 100560655
Entry
100560655         CDS       T01608                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100560655
   04115 p53 signaling pathway
    100560655
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100560655
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100560655
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 100560655
NCBI-ProteinID: XP_003222080
LinkDB
Position
6
AA seq 105 aa
MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQADGFSYTEANKSKGIIW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKDSTSK
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagacattgagaagggcaagaagatatttgttcagaagtgttcacagtgccacaca
gttgagaagggtggcaaacacaagactggccccaatctacatggtctgtttggccggaag
actggacaagctgatggtttctcttatacagaagccaacaaaagcaaaggtataatctgg
ggtgaagatacattgatggaatacttggaaaaccccaagaagtatattccaggaaccaag
atgatctttgctggtattaagaagaagggggagagggcagatttaatagcataccttaag
gactccacttctaagtaa

DBGET integrated database retrieval system