KEGG   Anolis carolinensis (green anole): 100559936Help
Entry
100559936         CDS       T01608                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00250  Alanine, aspartate and glutamate metabolism
acs00410  beta-Alanine metabolism
acs00430  Taurine and hypotaurine metabolism
acs00650  Butanoate metabolism
acs01100  Metabolic pathways
Module
acs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100559936
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100559936
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100559936
   00430 Taurine and hypotaurine metabolism
    100559936
Enzymes [BR:acs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100559936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 100559936
NCBI-ProteinID: XP_016851427
Ensembl: ENSACAG00000008555
LinkDB All DBs
Position
Un
AA seq 475 aa AA seqDB search
MVDILLSYIKKTYDRKSKVLDFHHPHQLLEGLEGFSVELSDQPQPLEQILVDCRDTLKYG
VKTGHPRYFNQLSSGLNIIGLAGEWLTATANTNMFTYEIAPVFIVMEEILLKKMYEIIGW
DESEADGIFSPGGSISNLYSVLVARYKRYPEIKTKGMAALPDIVLFVSEHSHYSVKKAAA
VLGIGMDNVIAIKCDERGKMIPSELEGNILKVKRQGKVPLYVSATAGTTVYGAFDPLTNI
ADICQKYNLWMHVDAAWGGGLLLSRRHAHKLSGIERANSVTWNPHKLMGVPLQCSAFLVH
EKGLLQACNQLCAGYLFQPDKQYDTAYDTGDKSIQCGRHVDVFKLWLMWRAKGTQGFEIL
INRFLELTEYLYKQLKKRKHYELVFDAEPELTNVCFWYIPPSLQKIPRGSERERRLHQIA
PKIKARMIEEGTTMVSYQPHGNNVNFFRMVFSNSATKKSDIDFLLEEIERLGKDL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggtggatattctcttgagttacatcaagaagacctatgacagaaaaagtaaagtgttg
gatttccatcatccgcatcagcttctggaagggctagaaggcttcagtgtggaactttct
gatcaaccccaacctttggaacaaatacttgttgactgcagggataccttgaaatatgga
gtcaaaacaggacatccacgttatttcaatcagctttcgagtggcctcaatattatagga
ctggctggagaatggctgacagctacagcaaatacaaacatgtttacatatgaaatagct
ccagtgttcattgtaatggaggagatccttctgaagaaaatgtatgaaattattggatgg
gatgaaagtgaagcagacggcatattttcccctggagggagcatatcaaatctctacagt
gttttagttgcccgctataaacggtaccctgagattaaaaccaaaggcatggcagccctt
ccagacattgtactatttgtttctgagcatagtcattattctgtaaagaaagctgcagct
gttcttgggatcgggatggataatgtgattgccatcaagtgtgatgaaagagggaaaatg
ataccatctgaactggagggaaacattctcaaagtcaaaagacagggcaaggttcccctg
tatgttagtgccacagctgggacaacagtatatggagcctttgatcctcttaccaacatt
gctgacatttgtcaaaagtacaacctctggatgcacgtggatgctgcatggggaggaggt
ttgctattgtcaagaaggcatgcccataaactaagtggtattgaaagggccaattctgtc
acctggaatccgcacaaattgatgggtgttccactgcagtgctcagctttcttagtacat
gagaagggtcttcttcaagcctgtaaccagctttgcgctggctatctcttccaaccagac
aaacaatatgacacagcttatgataccggggacaaatctatccagtgtggccgtcatgtc
gatgtcttcaaattatggctaatgtggagagccaagggcacacaaggatttgaaattctt
atcaacagatttttagaactcacagaatacctttataaacaattgaagaaaagaaaacac
tatgagcttgtttttgatgctgagcctgaactcaccaacgtgtgtttttggtacatccca
ccaagtcttcagaagatcccaaggggatcagaaagagaaagaaggcttcatcagatcgca
ccaaaaataaaagcaaggatgattgaagagggcacaacaatggttagctatcagcctcat
gggaacaatgtgaattttttcagaatggtcttctcgaattccgcaactaagaaatctgac
attgatttcctcttggaagaaattgaaagacttgggaaggatttgtga

DBGET integrated database retrieval system