KEGG   Anolis carolinensis (green anole): 100559955
Entry
100559955         CDS       T01608                                 

Gene name
pdpk1
Definition
(RefSeq) 3-phosphoinositide dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs03320  PPAR signaling pathway
acs04068  FoxO signaling pathway
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04510  Focal adhesion
acs04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100559955 (pdpk1)
   04150 mTOR signaling pathway
    100559955 (pdpk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100559955 (pdpk1)
  09143 Cell growth and death
   04210 Apoptosis
    100559955 (pdpk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100559955 (pdpk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100559955 (pdpk1)
   03320 PPAR signaling pathway
    100559955 (pdpk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100559955 (pdpk1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100559955 (pdpk1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100559955 (pdpk1)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   100559955 (pdpk1)
Membrane trafficking [BR:acs04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100559955 (pdpk1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Kdo
Other DBs
NCBI-GeneID: 100559955
NCBI-ProteinID: XP_003228307
Ensembl: ENSACAG00000003492
UniProt: H9G7Q7
LinkDB
Position
Un
AA seq 546 aa
MASTGSPLYDAVPIQSSVVLCSCPSPSMVRSQAEPSLPPVTASACGGRPELSMENALPQA
PVPQPQRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVT
RERDIMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYAAE
VVAALEYLHGKGIIHRDLKPENILLNGEMHIQITDFGTAKVLSADSRQARANSFVGTAQY
VSPELLTEKSACKSSDLWALGCIVYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPK
AKDLVEKLLVLDPTKRLGCEEMQGYGPLKGHPFFDSVTWEDLHRQTPPKLTAYLPAMSED
DEDCYGNYDNLLSQFGCMQVSGSASSQSLSSPETSLPPQTSGNNIEQYIHDLDSNSFELD
LQFSDEEKRLLLAKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYV
DPVNKVLKGEIPWSLELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEVWRHRY
HPNTAK
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggccagcaccggcagccccctgtatgatgctgttcccatccagtccagcgtggttttg
tgttcctgcccatcgccatccatggtgaggagccaagccgagcccagcctcccgcccgtc
actgcctctgcctgtggcggccggccagagctgagtatggagaatgccttgccgcaggca
cctgtcccgcagccacagcggaagaagcgccctgaggacttcaagttcgggaagatcctg
ggcgaaggctccttctcaactgtggtcttggccagagaattggctacctccagagaatat
gccatcaaaattctggagaagcgtcacatcatcaaggagaacaaagtgccctatgtaacc
cgggagagagacatcatgtcccgcctggaccaccctttctttgtcaaactctacttcaca
tttcaggacgatgaaaagctctattttggtcttagttatgccaaaaatggggagcttctc
aaatacatccgcaagatcggctcgtttgatgagacatgtacaaggttttacgctgccgaa
gttgtggctgctttggagtaccttcatggaaagggaattattcacagggatctgaagccg
gagaacattctcttgaacggagagatgcacattcagatcacagactttgggacagcaaaa
gtattatctgcggacagcagacaagcccgggcaaactcctttgttgggacggcgcagtat
gtgtcaccggaactcctcacagagaagtcagcttgcaaaagctctgacctatgggccctt
ggctgtatcgtctatcagcttgtggcagggctgccacccttcagagccggaaatgaatat
ctcatatttcaaaagataatcaagttggaatatgactttccagagaagttttttcctaaa
gcaaaagacctcgtagaaaagcttttggtcctagatcctaccaagcggttgggttgcgag
gaaatgcagggctacggacccctcaagggccaccccttcttcgactccgtgacctgggag
gatctgcatcgccagacgccacccaaactcaccgcctatttgcctgccatgtcggaggac
gatgaggattgctatggcaactatgacaacctgctgagtcaattcggctgcatgcaagtc
tccggctcggcctcttcccagtcgctgtcttccccggagacatctctgccaccacagacc
tcaggcaacaacatcgagcagtacatccacgaccttgatagcaactcctttgagctggac
ctccagttctctgacgaggagaagaggttgctgttggcaaagcaggcaggtggaaatccc
tggcaccagtttgtagagaataacctaatactgaagatgggtccagtagataagaggaag
ggcctctttgctcgccggcgccagctgctgctcaccgaagggccccacttgtactacgtg
gaccccgtcaacaaggtcctcaaaggagagatcccctggtccctggagctccgcccggaa
gccaagaacttcaagaccttttttgtccacacaccgaaccggacgtactacctgatggat
ccgagtgggaacgctcacaaatggtgcaaaaagatacaggaggtttggcgacacagatac
cacccaaacactgcgaagtga

DBGET integrated database retrieval system