KEGG   Anolis carolinensis (green anole): 100560103
Entry
100560103         CDS       T01608                                 

Gene name
casp9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs04370  VEGF signaling pathway
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100560103 (casp9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100560103 (casp9)
   04115 p53 signaling pathway
    100560103 (casp9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100560103 (casp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acs01009]
    100560103 (casp9)
   01002 Peptidases and inhibitors [BR:acs01002]
    100560103 (casp9)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100560103 (casp9)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100560103 (casp9)
Peptidases and inhibitors [BR:acs01002]
 Cysteine peptidases
  Family C14: caspase family
   100560103 (casp9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2 EPO_TPO
Other DBs
NCBI-GeneID: 100560103
NCBI-ProteinID: XP_008123821
Ensembl: ENSACAG00000015969
LinkDB
Position
Un
AA seq 403 aa
MEESHRALLRRNRVRLVKELRVDPLWDLLLQEGIFSQDMIEEIQGSGARSAQARQLCIDL
ETRGKRALPVFVHCLQETGQGALGDLLGRGANQVPESLSDHIRPVPIRTDTVAERPQEPR
PEITPIHGSGGEKSRRNSETAYVLTHDPCGYCLIINNVNFSEASQLGRRSGSDLDCERME
KRFKSLRFEVLTRRDLPAQAIAEELQSLARRDHSSMDCCLVVILSHGCQTSHVQFPGGIF
GTDGRRLAVEKMVSLFDGSHCPSLRGKPKIFFIQACGGEEKDRGFQVDLDPPFYNPASIE
SDAIAFQTQPGNTDEPDAIASLPTPSDILVSYSTFPGFVSWRDKLTGSWYIESLDQVLEQ
FVRSEDLLDMLLRVANAVSAKGTFKQMPGCFNFLRKRFFFMVR
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggaggagtcccaccgggctttgcttcgaaggaaccgggtccggctggtgaaggagctg
cgagtggatcccctttgggacctcctgctgcaggaggggatcttctcccaggacatgatc
gaggagatccaggggtccggtgcgcggagtgcgcaggcgcgacaactgtgcattgacctg
gagacgcggggcaagcgggctttgccggttttcgtgcactgcctccaggaaacgggtcaa
ggcgctcttggcgatctgctgggtcggggagccaatcaagtgcccgagagtctttcggac
cacatcagacccgtccccatccgtacggacacagtggcagaaagaccacaagaaccaagg
ccagaaattacaccaattcacggctccggcggagagaaatcccggaggaattcggaaaca
gcctatgtcctcacacatgacccgtgtggctactgcctcatcatcaacaacgtcaacttc
agcgaggcctcccaactcggccggcgctccggatccgacctggattgcgagcggatggag
aagcgcttcaagtccttgcgcttcgaggtcttgacccggcgggatctcccggctcaggcc
attgcggaggagttgcagagcctggccaggcgtgaccacagctcaatggactgctgcctt
gtggtcatcctttctcacggctgccagaccagccacgtccagttcccgggcggcattttc
ggcacggacggccgccgtcttgcggtggagaagatggtcagcctctttgacgggtcccat
tgccccagcctcagggggaagcccaagatcttcttcatccaggcctgcggaggagaggag
aaggaccgaggcttccaagtggatctggacccacccttttataatccggccagcattgaa
tccgacgcgatagctttccaaacccaaccgggcaataccgacgaaccggacgccattgcg
agtttgccgacccccagcgacatcttggtgtcttattccacgtttccagggttcgtgtcc
tggagggataagctgaccggctcctggtacatcgaaagcctggaccaagtcctggagcag
tttgtccgttcggaagacctgctcgatatgcttctccgagttgccaatgctgtctcggcc
aaagggaccttcaagcaaatgcccggctgtttcaacttcctccggaagcggttcttcttc
atggtccgatga

DBGET integrated database retrieval system