KEGG   Anolis carolinensis (green anole): 100560130Help
Entry
100560130         CDS       T01608                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00590  Arachidonic acid metabolism
acs01100  Metabolic pathways
acs04370  VEGF signaling pathway
acs04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100560130 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100560130 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100560130 (ptgs2)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100560130 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 100560130
NCBI-ProteinID: XP_003223472
Ensembl: ENSACAG00000001178
UniProt: H9G4Z6
LinkDB All DBs
Position
Un
AA seq 602 aa AA seqDB search
MLLPCAVLFALLALSHAVNPCCSNPCHNRGVCMTTGFDTYACDCTRTGYYGENCTTPEFL
TWLKLKLKPTPDMVHYILTHFKGVWNIINNIPFLHRAIMTYILMSRSHLIESPPTYNGHY
SYKSWEAYSNLSYYTRSLPPVEHNCPTPMGIKGKKELPDSQIIVEKFLMRRKFIPDPQGT
NVMFTFFAQHFTHQFFKTDHRKGPEFTKGLGHGVDLSHIYGETLDRQMKLRLLKDGKLKF
QMIDGEMYPPTVKDTQAEMIYPPHIPEHLRFCVGQEVFGLVPGLMMYATLWLREHNRVCD
VLKGEHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDTFNIQDQEYTYQQFVYNNSIMLDHGLSHMVQSFSKQIAGRV
AGGRNVPVAVLKVAKASIDQSRQMRYQSLNEYRKHFLLKPFQSFEELTGEKEMAAELKEL
YGDIDAMELYPALLVEKPRPGAIFGETMIELGAPFSLKGLMGNAICSPEYWKPSTFGGKV
GFDIVNTASLQRLVCNNVAGCPLTAFHVLTQETKATSNTSTTSASLDEINPAVLLKERSA
EL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcccctgcgccgtcctctttgccctcctggctttgagccacgctgttaatcct
tgctgttcaaatccatgccataacagaggagtgtgcatgacaacaggttttgacacatat
gcttgtgactgtacacgaactggatattacggggaaaactgcactacacctgaatttttg
acctggctgaaactgaaattgaagcctactcctgacatggtccactacatactcactcac
ttcaaaggtgtctggaacatcatcaacaacatcccattccttcacagagccatcatgaca
tatatattgatgtcaagatcccacttaatagagagtccaccaacatataacggccattac
agttacaaaagctgggaagcctactcaaacctttcatactacactcgaagtcttccacca
gtggaacacaactgccctactccgatgggtattaaaggcaaaaaggagcttccagattct
caaatcattgtggagaaatttttgatgaggagaaaatttatacctgaccctcaaggcaca
aatgtgatgttcacattttttgcccaacacttcactcaccagttcttcaaaacagatcac
cgcaaaggaccagagttcacaaaaggccttggacatggggttgatctgagtcacatttat
ggagagactttagacagacagatgaaactgagactacttaaggatggaaaactcaaattt
cagatgatcgatggagaaatgtatccacccacagtgaaagacactcaggcagaaatgatc
tatccaccccatatccctgagcacttgagattttgtgtagggcaagaggtctttggtttg
gttccaggactgatgatgtatgcgacattgtggctacgggaacacaaccgggtgtgtgac
gttcttaaaggggagcacccagaatgggacgatgaacagctgttccaaacaaccaggctg
atcttgataggtgaaaccattaagattgtgattgaagactatgtacagcatttaagtggc
tatcacttcaagctgaagtttgatccagagctgctctttaaccaacgattccagtatcag
aacagaatagcagccgagttcaacaccctctaccactggcatcctcttctgcctgatact
tttaacattcaggaccaagaatatacttatcagcagtttgtctacaacaattccattatg
ctggaccatggcctttctcacatggtacaatctttctccaagcaaatagctggaagggta
gctggaggccggaatgttccagttgcagttctgaaagtggctaaagcttctattgatcaa
agccggcagatgaggtaccaatccctgaatgaatatcgcaaacacttcctcctgaagcct
ttccagtcgtttgaagagcttacaggagagaaagaaatggctgctgaactcaaagagctt
tatggagacatcgatgcgatggagctgtatccagctcttttagtagaaaaaccacgtcct
ggagccatctttggtgagaccatgattgaacttggagcaccgttctccctgaaaggactc
atgggaaatgcaatttgctctcctgagtactggaagccaagcacttttgggggcaaagta
ggctttgacattgtgaacacagcttcgctccaaagacttgtctgcaataacgtggccggc
tgtcctcttacagcattccacgtgttgacccaagaaacaaaggcaacaagcaacaccagc
accaccagtgcatcgttagatgaaatcaatccagcagtactactaaaagagcggtctgca
gaactatag

DBGET integrated database retrieval system