KEGG   Anolis carolinensis (green anole): 100560141
Entry
100560141         CDS       T01608                                 

Gene name
rprm
Definition
(RefSeq) reprimo, TP53 dependent G2 arrest mediator candidate
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100560141 (rprm)
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 100560141
NCBI-ProteinID: XP_008115916
LinkDB
Position
Un
AA seq 118 aa
MNASSSSSPWAPLGNQTEAAGLLWANSSEALGRALRSSFTPRSVVSDDGFVVAAPDERSL
YIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaacgcctcttcttcgtcctcgccgtgggcgccgctgggcaaccagacggaggcggcg
ggcctgctgtgggccaacagcagtgaggcgctgggccgggcgctgcgctcctccttcacg
ccgcgctccgtggtgagcgacgacggcttcgtggtggccgcgccggacgagcggagcctg
tacatcatgcgcgtcgtgcagatcgccgtcatgtgcgtcctctcgctcaccgtcgtcttc
ggcatcttcttcctcggctgcaacctcctcatcaagtccgagggcatgatcaacttcctg
gtcaaggaccggcggccctccaaggaggtggaggccgtggtggtggggccttactga

KEGG   Anolis carolinensis (green anole): 103277771
Entry
103277771         CDS       T01608                                 

Definition
(RefSeq) reprimo-like protein
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    103277771
SSDB
Motif
Pfam: Tmemb_9 TrpP DUF5408
Other DBs
NCBI-GeneID: 103277771
NCBI-ProteinID: XP_008102247
LinkDB
Position
2
AA seq 147 aa
MLQASRRKGCWKKARQPLASSGEKQERDPAIARLPAASSCPPGSQMTNGTLSIRDASPPG
TIPPTMDSLVSSCCTLVTGAWVPKEDQRNQQVVRMVQIAVLCVLCLTVIFGVFFLGCNLL
IKSESMINMLVKERRPSREVEVVIIET
NT seq 444 nt   +upstreamnt  +downstreamnt
atgctgcaggcatccaggcgaaaaggctgctggaaaaaggcaaggcagccgttggcatct
tcaggggagaagcaggagagggatccagccatcgcaaggctcccggctgcatcctcctgc
ccgcctggctcgcagatgacaaacggcacgctctccatccgggatgcttcccctccaggg
accatcccccccaccatggactccctcgtctcctcctgctgcaccttggtgacgggggcc
tgggtgcccaaggaggaccaaaggaaccagcaggtggtgaggatggtacagatcgcggtg
ttgtgcgtgctctgcctgactgttatctttggggtgttcttcttaggctgcaacttgctg
atcaagtcggagagcatgatcaacatgctggtgaaggaacgcaggccctctagggaagtg
gaagtggtcatcattgagacataa

DBGET integrated database retrieval system