KEGG   Anolis carolinensis (green anole): 100560190Help
Entry
100560190         CDS       T01608                                 

Gene name
map3k14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04210  Apoptosis
acs04625  C-type lectin receptor signaling pathway
acs04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100560190 (map3k14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100560190 (map3k14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100560190 (map3k14)
   04672 Intestinal immune network for IgA production
    100560190 (map3k14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100560190 (map3k14)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100560190 (map3k14)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: STE group
  Other
   100560190 (map3k14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 100560190
NCBI-ProteinID: XP_003222577
Ensembl: ENSACAG00000016433
UniProt: G1KSM6
LinkDB All DBs
Position
6
AA seq 933 aa AA seqDB search
MAVMEIACQDTSVPAIGHPKELPMGKGQQKVAKEKTNSVCKVEDPDKHVFQGPWTILSDV
IAKGTAKEDNEKGSLASISIIAQAECEISQEFSPTYSERPFIADTKRYNRSCSLDQIPNN
VAHATEGKMAPAYWKGIHRSKSRKKRRKKKTQFKSFEGATSLTQKPRTPEQESCLPVQED
DSCLDTPFGNTSWHSEPLKDLGCDPHCFKKPNHAHNLNLLKSQSKLELHKLISPAQCLSH
VWKSHTLDNFAPQSKTLHPFPCDLFPPYIHGYDALIPALKIGPLGTYLFDDLSCVNVKNR
LSDLTLEHNFSKCSLQSVKTPPDKLSMDEFLVDALKGSVILGEARNLACLVKTWKEDGLS
SKAKPQEINENEGVLLIEKLKAVDYEYREDIHWTKFQGLLGTGSFGEVYKMEDKQTGFQC
AAKKMRIEHFREEELTTCTGMMHENILPLYGAVKEGLWITIFMKLMEGGSLGQLLKQSGY
LPEDRALHYLGQALKGLEYLHTHNVLHGDVKADNIVLSGDGNHAVLCDFGHAAHLHPDTM
GNYLMTGDYVPGTETHLAPEVVMGKRCNAKADVWSSCCMMLHLLNGCHPWTRYYNYPLCL
KIAKEPPPLREIPTSCHPSTAHVIKAGLEKEPAKRASAAELRLKANRALKHVGGLKSPWR
SEYREPRCLQMVKEISLPEPPLPALEPPSSMKPLIRSLSSPLPSQAPMERSPCVHPSACR
KLLWPYDSLQPPLPAPLSTKKSSFVEWKTATLEHDLQQLEFELILNSLSQPFSLEEQEQM
LSYLSLDSFLPSDASEKGSLKTSPSWKDTMSSGVHSWNSQADGQSNSWNSWLHCSKQTDV
PTYFNGVKIEIHLLSGESLHIREFHGVKVGDVATGISSQIPVSAFSFFSKEGQPVHCDME
IPDSGIELQCALAPDCSCGWSWRVKHGQLEKRP
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaattgcttgccaagacacttcagtcccagctatcggacatccaaag
gaacttcctatgggcaaagggcaacagaaagttgcaaaagaaaaaaccaacagtgtctgc
aaagtagaggatccagacaagcatgtgttccagggcccatggactatcctaagtgatgtg
attgctaagggaactgccaaggaagacaatgaaaaggggagcttagcctcaatctccatt
attgcccaggcagaatgtgagatcagccaggagttcagccccacctattcagagaggcca
tttattgctgataccaagcgatacaaccgatcttgcagccttgaccagatcccaaacaat
gtggcccatgcaaccgaggggaaaatggcacctgcttattggaagggcatacaccgaagt
aagtcccggaagaaacggcggaagaagaaaactcaattcaagtcattcgagggagcaacc
tccctaactcagaagccaaggactccagagcaggagagctgtctcccagtgcaggaggat
gactcctgcttggacacccctttcgggaacacctcatggcattcagaaccacttaaagat
ttaggctgtgatccccattgcttcaagaaacccaaccatgctcacaatctgaacttgctg
aagagccagtctaagttagaattgcacaagctgattagtcctgctcagtgcttgagccat
gtttggaaatcccacactcttgacaactttgcccctcagtcaaaaacactccaccctttc
ccttgtgacctgttccctccttatatccatggctatgatgccttgattcctgccttgaaa
attggtccactggggacatatctcttcgatgacctctcctgtgtcaatgtcaagaatcgc
ctgtcagacctgaccttggaacataacttctccaaatgcagccttcagtctgtaaaaaca
ccaccagacaagctttctatggatgagtttttggtggatgccttgaagggaagtgttatt
cttggggaagcaagaaacttagcttgtttggtgaagacatggaaggaagatggattgagt
tcaaaagcgaagcctcaagagattaatgaaaatgaaggtgtactacttattgaaaaactc
aaagctgtggattatgaataccgcgaagacattcactggacaaaattccaaggcttgctc
ggcacaggatcctttggggaagtgtacaaaatggaggacaagcagacaggctttcagtgt
gcagccaaaaagatgagaattgaacacttccgtgaagaggagttgacaacatgtactgga
atgatgcatgaaaatatcttgccattgtatggagcggtcaaagaaggcctctggattact
atattcatgaagctaatggaaggtgggtcacttggtcagctattgaagcagagtggctac
ttgccagaggacagagcacttcattatctgggccaagcattgaagggtttggaatatctt
catactcacaatgttctccatggagatgtaaaagctgacaacattgttttgtccggcgat
ggaaaccatgctgtcctctgtgattttggtcatgcagctcaccttcacccagatacaatg
ggaaattacttgatgacaggggattacgttcctggcaccgaaacccacttggcccccgaa
gtggtgatgggaaagcggtgcaatgccaaggcagatgtctggagcagctgctgtatgatg
ttgcatctcctgaatggctgccacccttggacccgatattacaattaccctttgtgcctc
aagatagccaaggaaccgcctcccctgagagaaatcccaacctcctgtcacccatccact
gcccatgtcattaaagctggccttgagaaggagccagccaaacgggcctcggcagcagag
ttgaggctgaaggccaacagagccctcaagcatgtggggggcctgaaaagcccctggaga
agtgaatacagagaacccaggtgcctacagatggtaaaagaaattagtcttccagaacca
ccattgccagcactcgagcctcctagtagcatgaagccattgatccgaagcctcagctca
ccactcccttctcaggccccaatggaaagaagcccatgtgtccacccaagtgcatgcagg
aaattgctgtggccatatgactccctgcagcctcccctcccagctcctctcagcaccaag
aagagcagctttgtggaatggaaaacagctaccttagagcatgaccttcagcagctggaa
tttgagctgattctgaacagtctctcccagcccttttctctggaggagcaagaacaaatg
ctttcctatctcagcttggacagttttctcccatcagatgccagtgagaagggttcttta
aaaacttctcccagctggaaggatacgatgagttcgggagtgcattcatggaacagccag
gctgatgggcagagcaacagctggaacagctggctacattgcagcaagcagacagatgtc
cccacctactttaacggggtgaaaattgagatccacttgctcagtggggagagtctgcat
atcagagaattccatggggtcaaagtgggagacgttgcaactggaatcagcagccaaatc
ccagtctctgcctttagcttcttctccaaggaaggccaaccagttcactgtgacatggag
attcccgactcaggcatcgagcttcagtgcgccctagcccctgattgtagttgtggatgg
agttggcgagtcaaacatggtcagctagagaagcgaccatga

DBGET integrated database retrieval system