KEGG   Anolis carolinensis (green anole): 100560441Help
Entry
100560441         CDS       T01608                                 

Gene name
gsto1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00480  Glutathione metabolism
acs00980  Metabolism of xenobiotics by cytochrome P450
acs00982  Drug metabolism - cytochrome P450
acs00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100560441 (gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100560441 (gsto1)
   00982 Drug metabolism - cytochrome P450
    100560441 (gsto1)
   00983 Drug metabolism - other enzymes
    100560441 (gsto1)
Enzymes [BR:acs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100560441 (gsto1)
Transporters [BR:acs02000]
 Other Transporters
  Pores ion channels [TC:1]
   100560441 (gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 100560441
NCBI-ProteinID: XP_003218563
Ensembl: ENSACAG00000005210
UniProt: G1KDR7
LinkDB All DBs
Position
3
AA seq 242 aa AA seqDB search
MSGDSSLSLGKGSLAPGPVPEGIIRLYSMRYCPFAQRTRLVLKAKGIKHEIVNINLKNKP
DWFFEKNPGGLVPVLETSKGQLIYESSITCEYLDEAYPENKLYPTDPYEKAFQKMTLELF
STLLSLAYKHLFGVKNGEDMSAVKKEYSEKLLKFEEILVNRNTTFFGGNSVSMIDYLIWP
WFERLELFQLQDCLDHLPKLKEWVEVMMLDPAVQATTSDLQKIKGFFDLYLKNSHEACDY
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggattcttctctgagtttaggcaaaggaagccttgctccaggacctgtgcct
gaaggaatcatccgtctctatagtatgcgctactgtccctttgcacagagaacacgacta
gtcctgaaagccaaaggaattaaacatgaaattgtgaatataaacttgaaaaataaaccc
gattggttttttgagaagaatcctggtggccttgtccctgtattggagacaagcaagggt
cagctgatttatgaatcttcgatcacttgcgagtatttagatgaagcatacccagagaat
aagctatacccgacagatccatatgagaaagctttccagaaaatgaccctggaactgttc
tccacgctgctttctctggcctacaaacatctttttggtgtgaagaatggagaagatatg
tctgctgtgaaaaaagagtactctgaaaagcttctcaaatttgaagagattctggtgaac
cgtaatactacgttctttggtgggaactcagtcagcatgattgactacctgatctggcca
tggttcgagcgcttggagctcttccagttacaagactgtctggatcatcttccaaaacta
aaagagtgggttgaagtcatgatgctcgatccagctgtccaagcaacaacatcagatctt
cagaagatcaaaggtttctttgatctgtacctgaaaaatagccatgaggcctgtgactat
gggctctga

DBGET integrated database retrieval system