KEGG   Anolis carolinensis (green anole): 100560663Help
Entry
100560663         CDS       T01608                                 

Gene name
aldh7a1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00010  Glycolysis / Gluconeogenesis
acs00053  Ascorbate and aldarate metabolism
acs00071  Fatty acid degradation
acs00260  Glycine, serine and threonine metabolism
acs00280  Valine, leucine and isoleucine degradation
acs00310  Lysine degradation
acs00330  Arginine and proline metabolism
acs00340  Histidine metabolism
acs00380  Tryptophan metabolism
acs00410  beta-Alanine metabolism
acs00561  Glycerolipid metabolism
acs00620  Pyruvate metabolism
acs01100  Metabolic pathways
Module
acs_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
acs_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100560663 (aldh7a1)
   00053 Ascorbate and aldarate metabolism
    100560663 (aldh7a1)
   00620 Pyruvate metabolism
    100560663 (aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100560663 (aldh7a1)
   00561 Glycerolipid metabolism
    100560663 (aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100560663 (aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    100560663 (aldh7a1)
   00310 Lysine degradation
    100560663 (aldh7a1)
   00330 Arginine and proline metabolism
    100560663 (aldh7a1)
   00340 Histidine metabolism
    100560663 (aldh7a1)
   00380 Tryptophan metabolism
    100560663 (aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100560663 (aldh7a1)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100560663 (aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     100560663 (aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     100560663 (aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100560663
NCBI-ProteinID: XP_003223068
Ensembl: ENSACAG00000002899
UniProt: H9G6Y7
LinkDB All DBs
Position
Un
AA seq 545 aa AA seqDB search
MLLQLGLSALGRRAWRRKPLCLASRLWKAPSSAPMSTLLVNQGPYAWLKELGLQEENAGV
YNGSWGGRGEVVTTYCPANHQPIARVRQASLEDYEETVKKAQEAWQVWAEVPAPKRGEIV
RQIGDALRQKIKVLGNLVSLEMGKITAESVGEVQEYVDVCDYAVGLSRMIGGPVLPSERP
GHALIEQWNPLGLVGVISAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLTSVAVTKIL
AQVLEANKLPGAICSLICGGADIGTAMAKDERIDLLSFTGSTNVGKQVALKVQERFGRFL
LELGGNNAIIVFEDADLDLVIPSSLFAAVGTAGQRCTSTRRLFLHESIHDEVVSRLAKAY
LQVRIGDPLDANTLYGPLHTKQAVQMFVDTVELAKQQGGSVVYGGKVLDRPGNYVEPAIV
TGLPHNATVVQTETFAPILYVLKFKTEDEAFAWNNEVKQGLSSSIFTKDLGRIFRWLGPK
GSDCGIVNVNIPTSGAEIGGAFGGNKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQ
GIKFQ
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgcagctgggcctctccgctctgggcaggcgcgcgtggcggcggaagcccctc
tgcctggcgtcccgcctctggaaggctccctcctccgctccgatgtcgacgctgctggtc
aaccaagggccctacgcctggctcaaggagctcgggctccaggaggagaacgcgggcgtc
tacaatggctcctggggaggaagaggagaggtggtgacaacatattgccctgcaaatcat
cagccaatagccagagttcgacaggcaagtttggaagactatgaagaaacagtaaagaaa
gctcaagaagcttggcaagtatgggcagaggttcctgctcccaaaagaggagaaatagtg
agacagattggtgatgccttgagacagaaaatcaaagttcttggaaatttggtgtctttg
gagatgggaaaaatcacagctgagagtgttggtgaagtacaggaatatgtagatgtctgt
gactatgctgttggcttatctcgaatgattggtgggcctgtcttaccttcagaaagacct
ggacatgccttaatagagcagtggaatcccctgggattagttggagtcatctcagcattt
aactttcctgtggccgtttatggctggaacaatgcaattgcaatgatctgtggcaatgtt
tgtctctggaaaggtgcccccacaacatctctcactagtgtcgctgttacaaaaatactt
gcccaggttttggaagctaacaaattgccaggtgctatctgttctctaatatgtggtgga
gcagatattggcacagcaatggcgaaggatgaaagaattgatttgctatccttcacgggt
agcacaaatgtgggcaagcaagtggcccttaaggttcaagaaaggtttggaagatttctg
ctggagcttggaggaaacaatgctataattgtttttgaagatgctgacctggacctggtc
attccatcttctctgtttgcagccgtggggacggcaggccagcggtgcacgtcaacaaga
aggctgtttttgcatgaaagcattcacgatgaagtggtgtcaagactggctaaagcatat
ttgcaggtccgcattggagatccattagacgctaacaccctgtatggtcctcttcataca
aagcaagcagtacagatgtttgttgatacagtggaacttgccaaacaacaaggtggctcc
gtggtctatggtgggaaggttctagaccgtcctggaaactatgttgaacctgccatcgtg
accggtcttccacataatgcgactgttgtgcagacagagacatttgctcctattctgtat
gtgttaaaatttaagacagaagatgaagcctttgcctggaacaatgaagtcaaacaaggc
ctgtctagcagcatctttaccaaggatttgggcagaatattccggtggcttgggcctaaa
ggatcagactgtggtattgtaaatgtgaatattccaactagtggggctgaaatcggaggt
gcctttggtggcaataaacacactggtggaggaagggagtctgggagtgattcgtggaag
cagtatatgagaagatccacttgcacaatcaattacagcaaggatttgcctcttgctcaa
ggaatcaagttccagtaa

DBGET integrated database retrieval system