KEGG   Anolis carolinensis (green anole): 100561046
Entry
100561046         CDS       T01608                                 

Gene name
kitlg
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100561046 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100561046 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:acs04052]
    100561046 (kitlg)
Cytokines and growth factors [BR:acs04052]
 Growth factors
  Growth factors (RTK binding)
   100561046 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 100561046
NCBI-ProteinID: XP_008109097
Ensembl: ENSACAG00000029213
UniProt: R4GD07
LinkDB
Position
5
AA seq 283 aa
MKTAQTWIITCFYLQLLLLHPLVKTQSPCGNPVTDDVNDIAKLVGNLPNDYMIALKYVRK
MDTLPNHCWLHLMVPELSKSLSNLLNKFTEFSDMPDVLSNYSIINNLRRIINDLMECLSS
TKYRNFRQHHDHLYEEGRFIPEEFFKHFSNTVESYKILAKTPVQSDCVLPSTTETPPNDS
RLSVTKSFLSYPFAASHLKNDSSGNHNNEAALGFLGSPGMQGLSIALTSLVTLFIGFILG
AVCWKKTARKHILESNPTTQANICQEDNEISMLQQKDKSLLQV
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaagacggcacaaacttggattatcacttgcttttatcttcaactgctcctgcttcat
cctcttgtcaagacccaaagtccctgtgggaatcctgtgacggatgatgtgaatgacatt
gcaaaactggttggaaatcttccaaatgattatatgatagcccttaaatatgtccggaag
atggatacgttgcctaatcattgttggttgcatctgatggtacctgagctgtcaaagagt
ctgagtaatcttctcaacaaatttacagagttttcagatatgccagatgtcttgagtaat
tattcaattatcaataatcttcgaaggatcatcaatgatctaatggaatgcctgtcatct
acgaaatataggaattttagacaacatcatgaccacctttatgaagaaggtagatttatt
ccagaagaattctttaagcactttagtaacactgttgaaagttacaaaatattggcaaaa
acaccagtacaaagcgactgtgttttgccatcaacaacagagactcctccaaatgattcc
aggctcagtgttacaaagtcatttttgtcatatccttttgctgccagccatctaaagaat
gacagcagtggcaatcacaataacgaagcagcattgggtttccttggtagccctggcatg
caaggactgagcatagcgctaacgtcactggtgactctttttattggctttattttgggt
gctgtatgctggaagaaaacagcccggaaacatatactagaaagtaacccgactacacaa
gctaacatctgccaagaggataatgaaataagtatgctgcagcaaaaagacaaatccctt
ctacaagtgtag

DBGET integrated database retrieval system