KEGG   Anolis carolinensis (green anole): 100561200
Entry
100561200         CDS       T01608                                 

Gene name
nos2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00220  Arginine biosynthesis
acs00330  Arginine and proline metabolism
acs01100  Metabolic pathways
acs04020  Calcium signaling pathway
acs04146  Peroxisome
acs04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100561200 (nos2)
   00330 Arginine and proline metabolism
    100561200 (nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100561200 (nos2)
   04020 Calcium signaling pathway
    100561200 (nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100561200 (nos2)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100561200 (nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 100561200
NCBI-ProteinID: XP_003228867
Ensembl: ENSACAG00000015623
UniProt: H9GMP6
LinkDB
Position
Un
AA seq 1327 aa
MQKSPPSVLLFSMLDTNKTMKSRLFHDVPLLPSSGHVNIAPTVLFPSIKAGIPILRPAGH
IRPPGAIYPPPPPTAFPTFLRCPAPSTSLGDLPFHLSRHFSAIQAFEPLLAPHSPCISRG
GSLPFRFYRNSKGETHLESFQLSRRKSEVCLFGTEFSPAQWDALPERIGEVPRIPPPNMQ
NMMCPWPLFFKPPTGKNKSQGDKDINNNMEKAAQHVCSLAKQDGTILSPEPDVIIPAATA
REKCLPNGDKQSSRCPRNLKIKNWEHGMTLQDTLHHEAKEVLSCRSSVCQGSLMNSPALV
RGPRDEPVPKDELLHQATEFIHLFYGSSKELKSDHLARLEVVAEEIETTGTYQLTGDELI
FAAKQAWRNAPRCIGRIQWSNLQVFDARNCATAKEMFAHLCRHLEYSTNEGKIRSAITVF
PQRTNGKHDFRIWNSQLIRYAGYQTPDGSVVGDPANVELTQLCIQLGWKPRHGRFDVLPL
ILQADGQDPELFELPPELVLEVPMEHPTYEWFKDLGLKWYAVPAVSNMLLEAGGLEFTAC
PFNGWYMGTEIGVRDFCDTQRYNILQDVGKRMGLETNKLSSLWKDKAVIEVNVAVLHSFQ
KRNVTIMDHHSATDSFMKYMQNEYRIRGGCPADWVWLVPPISGSITTVFHQEMLNYILSP
FYYYQVDAWKTHVWKDERRKPRKREIKFRIWAKAVLFASALMRKAVALRIQATVLYATET
GKSETLAHNLGDLFNCAFNAKVICMDDYNLTDLEKEHLLLVVTSTFGNGDSPSNGKIFQN
ALLSTKQLSNKLRYGVFGLGSSMYPEFCAFARAIDQKLTQLGASPVTPMGEGDELNGQEE
AFRAWAVDTFKTSCDIFDICGKHRILLPKAYTSNEIWNPKDFRIAYDAQPLDLGKALGDI
HGKNVILMELASRKNLQTPKSSRVTLLIKLSCQASQEVKYLPGDHMGIFPANPNALIDGI
VSRIADAPPTNEIIRLETRSDRGYWAGDKKLPACTFAQALMHFLDVTSPPSQRFLQTLAQ
WAKDDREKERLNCLCHSLEEYNKWKFFRSPTILEVLEEFPSVEVSAAFLLSQLPLLKPRY
YSISSSQDWDPKEIHLTVALVAYRTQDGNGPVHHGICSTWLNTINLKESIPCFVCSADGF
RLPKDFQKPCILIGPGTGIAPFRSFWQQRLYDLEIKGIRGRGMMLLFGCRHANLDHLYKD
DMEEMLRKGIFQGIHTAYSREPGRPKVYVQDLLQKALASKVCQLLHEEEGHLYVCGDVRM
ARAVAKTMKEMFAKQLGLTEEQAEDYCFQLKRQKRYHEDIFGAVFAHENQRDTRPRPGFE
SPNPLTF
NT seq 3984 nt   +upstreamnt  +downstreamnt
atgcagaagtctccgccctcagtgttgttgttttcgatgctcgacactaataaaaccatg
aaatcaaggctattccatgatgtccctttgctgccatccagtggacatgttaatattgca
cccaccgtgctattcccttccattaaagcagggatccccatactacggcccgcgggccac
atccggccccctggagccatttatccgccccccccccccacagctttccccactttcctg
cgttgtcccgctccctctacaagccttggagacttgcctttccacctttcccgccacttt
tctgctatacaagcctttgagcctctcctggctccccactctccctgcataagccgtgga
ggatccttgcctttccgcttttaccgcaactcaaaaggagagacccacttggaaagcttt
caactctcccgccgaaaatcagaggtatgtctattcggaactgagttcagcccggctcaa
tgggatgccctcccagagaggatcggagaggtgccaagaatccctccacctaatatgcag
aacatgatgtgcccttggcctttattctttaagcctccgaccggcaagaacaagtcccaa
ggcgataaggatattaacaacaatatggaaaaagccgcccagcacgtctgcagcttggcc
aagcaagacggaaccatattgagccccgaaccggacgtgatcatccccgccgcaacagcg
agagaaaaatgcctcccgaacggcgacaagcaaagctcccgatgcccgaggaacttgaaa
attaaaaactgggaacacggaatgacgctccaagacacattacaccacgaggcgaaagag
gtgctgagctgccggtccagcgtctgccaagggtccctcatgaacagcccagctttggtc
agaggtccccgagacgagcccgtccccaaagacgagttgttgcaccaagcgaccgagttt
atccatctgttctacggttcgtccaaagagctgaaatcagaccacctcgctaggctggaa
gtggtggccgaagagatcgagacaaccgggacttaccagctgaccggagatgagctcatc
tttgcggcaaagcaggcctggagaaatgcgccgcggtgcatcgggagaatccagtggtcc
aatttacaggtgttcgatgctcgtaactgcgccacggccaaggagatgtttgcgcacctc
tgccgtcatttggagtattcgaccaacgaaggcaagatcaggtcggccatcacggttttc
ccccagaggaccaacgggaagcacgacttccgaatatggaacagccagctcatccgatac
gccggataccaaacgccagacggttccgttgtgggcgatccggccaatgtggagctcaca
cagctctgcatccaactgggttggaagcccagacacggccgctttgatgtccttccactc
atcctccaggcggacggccaagacccagagttatttgagctcccgccagaactggtcctc
gaagtgccgatggagcatcccacatacgaatggtttaaagacctgggcctgaagtggtat
gccgtcccggccgtctcgaacatgctcctcgaggccggagggctggagtttacagcttgc
cctttcaacggctggtacatggggaccgagatcggggtgcgggacttctgcgacacgcag
cgctacaatatactccaggacgtggggaaaaggatgggtctggaaacaaacaagctctct
tccctatggaaagacaaagctgtgattgaagtcaatgttgccgtgctacatagctttcag
aaacgcaatgtcaccatcatggaccaccattcggccacggactccttcatgaagtacatg
cagaacgagtaccggatccggggagggtgtccggccgactgggtttggcttgtgcctccc
atttcgggcagcatcacgacggttttccaccaggagatgttgaattatatcctctcccct
ttctattattaccaggttgatgcatggaaaacccatgtttggaaagacgagaggcgcaag
cccaggaaacgggagatcaagtttcgcatctgggccaaggccgtgctgtttgcatctgcg
ctgatgcgcaaagccgtggcgctcaggatccaagcgaccgtcctctacgccaccgaaacg
ggaaagtccgaaaccctggcccataatcttggagacttattcaactgtgccttcaacgcc
aaggtcatttgtatggacgattacaacttgacggaccttgagaaggaacatctactcctg
gtggtcacgagtacttttggaaacggagattccccgagcaatggaaaaatatttcagaat
gccctcctctcgacaaaacaactaagcaacaagctcagatacggcgtctttggcttgggt
tcaagcatgtaccccgagttctgtgcctttgcccgggccattgaccagaaactcacacag
ctgggggcgtctccagtcaccccgatgggcgaaggggatgaactcaatgggcaagaagaa
gctttccgagcctgggccgtggatacattcaagacgtcctgtgacatttttgatatctgt
ggcaagcacaggatcctgctacccaaagcttacacaagcaacgaaatctggaaccccaag
gattttcggattgcgtatgatgctcagcctttggatttgggcaaagcactcggggatatc
catgggaaaaatgtcatcctgatggagctcgcatctcggaagaatctgcaaacgccaaag
tcaagccgcgtcaccctcctcattaagctttcctgccaggccagccaggaagtcaagtat
cttcccggggaccatatgggcatcttccctgccaaccccaatgccctcatcgacggcatc
gtttcccgtattgcggatgctcctccgaccaacgagatcattcggttggaaacgcggagt
gaccgtggatactgggccggcgacaagaagctccctgcttgcaccttcgcccaggcgctg
atgcatttcctggacgtcaccagccctccttcccagagatttctccaaacgctggcccag
tgggccaaggacgaccgggagaaggagcggctcaactgcttgtgccacagcttggaggag
tacaacaagtggaagttcttccgcagccccaccatcctggaggtcttggaggagttcccc
tccgtcgaggtctcggccgccttcctgttgtcccagctgcctttgctgaagcccaggtat
tactccatcagttcgtcgcaggattgggaccccaaagagattcacctgaccgtcgccttg
gtcgcctataggacacaagatggaaacggtccagtgcaccatgggatatgcagtacttgg
ctgaatacgatcaacttgaaagagagcatcccttgcttcgtttgcagtgccgatggattt
cgacttcccaaagatttccaaaaaccatgcattttgattggcccagggacagggatcgct
ccgttcagaagcttctggcaacaacgtctctatgacctggaaatcaaaggcatccgaggg
agagggatgatgctcctgtttggctgccggcacgccaacctggaccacctctacaaagac
gacatggaggagatgctccggaaaggcatcttccaagggatccacactgcctactccaga
gagccaggccgtcccaaagtctatgtgcaagatcttcttcagaaggctctggcatccaaa
gtgtgccaactcctacatgaggaggaaggtcacctgtacgtctgtggggacgtccgcatg
gccagggccgtggccaaaaccatgaaggagatgtttgctaagcagctgggcttaacggaa
gagcaagcggaggactactgcttccagctgaagagacaaaagcgataccacgaggacata
ttcggggcggtgtttgcgcacgagaaccaacgagacacgagaccacgacccggcttcgag
tctccaaatccgctcacgttttag

DBGET integrated database retrieval system