KEGG   Anolis carolinensis (green anole): 100561470
Entry
100561470         CDS       T01608                                 

Gene name
steap3
Definition
(RefSeq) STEAP3 metalloreductase
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100561470 (steap3)
   04115 p53 signaling pathway
    100561470 (steap3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100561470 (steap3)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     100561470 (steap3)
Membrane trafficking [BR:acs04131]
 Exocytosis
  Others
   Others
    100561470 (steap3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct 2-Hacid_dh_C IlvN Shikimate_DH NAD_binding_2
Other DBs
NCBI-GeneID: 100561470
NCBI-ProteinID: XP_008118990
Ensembl: ENSACAG00000016141
LinkDB
Position
Un
AA seq 488 aa
MPVGDMGKPLLGHQNGGSDPSLVPGTSGRTIGVLGSGDFARSLSMRLVCSGFKVVVGSRN
PKRSASLFPSAAEVTFQADAIKKTDIIFVAVFREHYTTLCDLSDELSGKILVDVSNNAEI
NHHKESNAEYLASLFPACTVVKGFNVISAWTLQSGARDGNKQVYICCDNQEAKRAVGEIA
HMLGFTPVDMGALVSAREIENIPLRLLPAWKIPVFLALGLFLCFYTYNFIRQVLHPYILD
KKNKFYKMPVEVVNTTLPCVAYVMLSLVYLPGVLAAAFQLYHCTKYKRFPDWLDQWLQHR
KQIGLLSFFCAALHAVYSLCLPMRRSHRYLLLNEAVKQVEKKADAWVEEEVWRMEVYISF
GIMALGLLSLLAITSLPSISNSLNWREFSFIQSSLGFVALVISTLHTLTYGWGRAFDESQ
YKFYLPPTFTLTLLVPCVIILAKLFFHLPCMNERLRRIRKGWERGRYVKFTLPRASGEFS
SGESSSIV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgccagtgggcgacatggggaagccactgctgggccaccagaatggaggcagcgaccca
agcctggtcccaggaaccagtggcaggacaattggggtcctgggaagtggagactttgcc
cgctccttgtccatgcgcctggtgtgctccggtttcaaagtggtggttggaagccggaac
cccaagcgcagcgccagcctcttcccttcagctgctgaagtgacgttccaggcagacgct
atcaagaagacagatattatctttgtagcagttttcagagaacattacaccacactctgc
gacctcagcgatgagctgtctggcaaaatattggttgacgttagcaacaatgcggaaata
aaccatcacaaagaatcaaatgcagagtacttggcatcacttttcccagcgtgtactgtc
gtcaaaggatttaatgtcatctcagcatggaccttacagtcaggcgccagggatggcaat
aaacaggtctacatttgctgtgacaaccaggaagccaaacgtgccgtcggggaaattgct
catatgctgggcttcacacccgtggacatgggtgccttggtctcagcccgtgagattgag
aacatccccctccgcctcctccctgcttggaagatccctgtcttcttggccctgggtctc
tttctctgcttctacacctacaactttattcgacaggttttgcacccatacatcctggat
aaaaagaataagttctataagatgcccgtggaggtcgtcaacaccaccctgccttgtgtc
gcctacgtcatgctctcccttgtctacctgcctggagtgctggccgctgccttccagctc
taccactgcaccaagtacaagcgtttcccagactggcttgaccagtggttgcaacacaga
aagcagatagggctgctgagcttcttctgcgcagctctgcatgctgtgtacagcttgtgc
ttacccatgcgccggtcccaccggtacctgttactcaatgaagctgtcaagcaggtggag
aagaaagccgatgcctgggtagaggaggaagtttggagaatggaggtctacatttctttc
ggcatcatggccctgggcttactctcattacttgccataacttcacttccttccatctcc
aactcactcaattggagagaattcagtttcattcagtccagccttggctttgttgcgctg
gtgatcagcactctccataccttgacatatggctggggaagggccttcgatgagagccaa
tacaagttctacctgcctcctaccttcaccctcacactgctggtgccgtgtgtcatcatc
ctggctaaacttttcttccatcttccttgtatgaacgaaagactgcggcgcatcaggaaa
gggtgggaaaggggcaggtatgtcaaattcaccttgcccagagcatcgggggagttctca
agtggagaaagcagcagcattgtgtga

DBGET integrated database retrieval system