KEGG   Anolis carolinensis (green anole): 100561699Help
Entry
100561699         CDS       T01608                                 

Gene name
smyd1
Definition
(RefSeq) SET and MYND domain containing 1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00310  Lysine degradation
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100561699 (smyd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acs03036]
    100561699 (smyd1)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     100561699 (smyd1)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     100561699 (smyd1)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100561699 (smyd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND
Motif
Other DBs
NCBI-GeneID: 100561699
NCBI-ProteinID: XP_003222415
Ensembl: ENSACAG00000008484
LinkDB All DBs
Position
6
AA seq 472 aa AA seqDB search
METVEVFDTDGKGRGLKAAKEFWAGDVIFAERAYAAVVFDSLTHLVCHTCFKRHAKLHRC
GQCKFAHYCDRTCQKDAWVNHKNECAAIKKHGKAPNENIRLAARIMWRIEREGGGLTEGC
FVSIDSLQNHVEHFGEEEKKELRLDLESFLEFWPHDGKQFAMQYISHILGVINCNGFTLS
DQRGLQAVGVGIFPNLCLVNHDCWPNCTVIFNNGKIELRALGKISIGEELTVSYVDFLNV
CEDRRQQLKKQYYFDCTCEHCQKGIKDDLMLAVKEEEKPSPEVVKDVIQFSKEAIEKIDK
ARSEGLYKEVVKLCRACLEKQEPVLGDTNIYMLRILSILSEVLSYLQHVDEAAGYSKRMA
DGYLKLYHPNNAQLGMALMRAGVTHWHAGLIEAGHGMICKAYAILLVTHGPTHPITKDLE
AMRIQTEMELRMFQQNEFMYYKMREAALQNQQIQVLPEPTNEISPGIFQKKQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgtggaggtgtttgacacggatggcaaaggcagggggctgaaggcagccaag
gaattctgggctggagatgtaatttttgcagaacgggcctatgctgcagtagtatttgac
agcctcacccatcttgtctgccatacatgctttaaaaggcatgcaaaactccatcgctgt
ggccagtgcaagtttgcccactactgtgaccggacctgccagaaggatgcctgggtgaac
cacaagaatgagtgcgctgccatcaagaaacatgggaaagcacccaatgaaaacatccgg
ttggctgcccgaatcatgtggagaatagagagagaaggaggaggcctgacagagggatgt
ttcgtctccatcgatagcctgcagaatcatgtggagcattttggagaagaggagaagaaa
gagctgaggcttgacctggagagtttcctggagttctggccacatgacggcaagcagttt
gccatgcagtacatctctcacatcctgggcgtgatcaactgtaatggtttcaccttgagt
gaccaaaggggcctgcaagcagttggcgtgggcatctttcccaacctttgcctggtaaac
catgactgttggcccaactgtaccgttatcttcaataatggcaagatagagctgcgtgca
ttggggaaaatctccataggggaagagctgaccgtttcttatgtggacttcctcaatgtg
tgtgaagacagaaggcagcagttgaaaaagcaatattattttgactgcacctgtgaacat
tgtcagaaaggaatcaaagatgatctgatgttggcagtgaaagaagaagaaaagccatcc
ccagaagtagtgaaagatgtcattcagttctccaaagaagcaatagaaaaaattgacaaa
gctcgttccgaagggttatacaaagaagttgtaaagctgtgtcgagcatgtctagaaaag
caggaaccagtgctaggagacaccaacatttacatgctccggatcctgagcattttgtca
gaagtcctctcttacctccagcacgttgatgaggcagctggatactcaaaacgaatggcg
gatggctacttaaagctttaccatcccaacaatgcacaacttggaatggctcttatgaga
gcaggagtgacccattggcatgctggtctcattgaagcagggcatgggatgatttgcaaa
gcttacgctattcttcttgtgacacatggcccaacacatccaatcaccaaagatctagag
gccatgaggattcagactgagatggagctgcgcatgttccagcagaatgagtttatgtac
tacaagatgagagaggcggctttgcagaaccagcagatccaggtcttgcctgaacccacc
aatgagatttcacctggcatcttccagaagaagcaataa

DBGET integrated database retrieval system