KEGG   Anolis carolinensis (green anole): 100561739Help
Entry
100561739         CDS       T01608                                 

Gene name
lsp1
Definition
(RefSeq) lymphocyte-specific protein 1
  KO
K14957  lymphocyte-specific protein 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100561739 (lsp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon YABBY
Motif
Other DBs
NCBI-GeneID: 100561739
NCBI-ProteinID: XP_008106244
Ensembl: ENSACAG00000009592
LinkDB All DBs
Position
1
AA seq 424 aa AA seqDB search
MADHVEECVKDPESDIGVEEGDLGETERLTAQWSVEDEEEAARERRRRERERQLRSQAEE
GLVSTSTSSESGLIPQESQIDGKPAGTSELEEDEGFSDWSLKLEQRKQRWAEMGEAAPNG
YRTCYGECTEAQQVTSTTWEGRSPKHSCEEDGNLMEAEAKLEQVQLGQDSPTFIRFTPGP
SSFLKFVSTSVSQEQPEAELEGQQKLIETACVGEENQDMAEVFPEVQEEIKHEEEEEKQE
EKKRRWKEEEEAPEKRQRAPSTSSNEEEGELPLSPTLKITDRTECLNRSIQKSNSVKKTQ
PPLPVAKIDDKLEQYTHAIETSSKTPKPVRQLSIDLPANSAAVTSTKNLWETGEVVQSPV
KTTPCKDIVAGDIVSKRSIWEQKESPNADGSAKVKLPGKKYRYVAIGHGKYKKVLIEDET
SAEK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcacgtagaggaatgtgtgaaagaccctgagagtgacatcggtgtggaggaa
ggtgacctgggtgaaacagaaaggctgacagcacaatggagtgtggaagatgaagaggaa
gcagcaagggaacgccgacgaagggaacgtgagagacaacttagatctcaggctgaagaa
ggcctcgtcagcaccagcacgtcttccgagagtgggctgatcccacaagaaagccagatt
gatggaaagccagctggaacttcagaactggaggaagatgaaggctttagtgactggtcc
ctgaagcttgagcaacgcaagcagagatgggcagaaatgggagaagcagcaccaaatgga
tatcgcacgtgctatggtgaatgtacagaagcccaacaggtgacttctacaacatgggaa
ggaaggtcaccaaagcattcctgtgaagaagatggcaatctgatggaagcagaagccaaa
ctagagcaggtgcagctaggtcaggactcccccaccttcatccggtttacacctgggcct
tccagcttcctcaagtttgtttcaacttcagtgtcccaagagcagcctgaagcagagctg
gaggggcagcagaagcttattgaaacagcttgtgttggagaagagaaccaagacatggcc
gaagtattcccagaagtccaagaagaaattaaacatgaggaagaggaagaaaagcaggag
gaaaagaaaagaagatggaaagaggaggaagaggcaccagaaaagcgacaaagagctcca
agcacatctagcaatgaagaagagggtgagctcccgctaagtcctactttaaagattact
gacagaactgaatgtctgaaccgctccatacagaaaagtaacagcgtgaagaagacacaa
ccacctctccctgttgcaaaaattgatgacaaacttgaacagtacacacatgccattgag
acttccagcaagacacccaaaccagtgcgccagctttccattgaccttcctgccaacagt
gctgctgtgaccagcacaaaaaatctttgggagactggtgaagtggttcagtctcctgtg
aagacaacaccctgtaaggacattgtggctggagacattgtgagtaagagaagcatttgg
gagcagaaagaaagcccaaatgcagatggaagtgcaaaggttaagcttcctggcaagaag
tataggtatgtggcaattggacatggcaaatacaaaaaggtgttgatcgaagatgagaca
tcagcagaaaaatag

DBGET integrated database retrieval system