KEGG   Anolis carolinensis (green anole): 100561813Help
Entry
100561813         CDS       T01608                                 

Gene name
gaa
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00052  Galactose metabolism
acs00500  Starch and sucrose metabolism
acs01100  Metabolic pathways
acs04142  Lysosome
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100561813 (gaa)
   00500 Starch and sucrose metabolism
    100561813 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100561813 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100561813 (gaa)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100561813 (gaa)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100561813 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100561813
NCBI-ProteinID: XP_003217162
Ensembl: ENSACAG00000015793
LinkDB All DBs
Position
2
AA seq 925 aa AA seqDB search
MLLIEKPEHRGLCVILWVFISITLLSVSGTHGAPQEAEKRGREKDRGGEAEEQHEKLADQ
PDLLRSSSIQPTQCDIPPDSRFDCAPDKLLSQEECEARGCCYIPAQPKGNAIWQPWCFFP
PSYPSYKMVNLTTTKTGYTAQLTRDRPTFMPEDIMNLELDVLFETESRLHFTLKDPANKR
YEVPLETPQSSNKASSTWYSVQFSDDPFGLIILRTSNGRVLLNTSVAPLFYADQFLQIST
SLPSHFISGLGEHLTSLTLSVNWTKVTMWNRDMSPMPSANLYGSHPFYLVLEEDGLAHGV
FLLNSNAMDVILQPSPALTWRTTGGILDFYVFLGPDPKSVVRQYMDVIGYPFMPPYWALG
FHLCRWGYASTAVTREVVKNMTAAQFPLDVQWNDLDYADAGRDFTFNKDAFGDMPEMVNE
FHREGRRYVMIVDAGISSSSPTGTYKPFDEGLKRGVFILNATGQPLIGKVWPGPTAFPDF
TNPETHQWWHDMVKDFHDQVPFDGMWIDMNEPSNFVEGSVEGCPNNKLEAPPYVPGVLGG
SLKSRTLCASSKQYLSSHYNLHSLYGLTEAIASHDALVKVRGKRPFVISRSTFASHGRYA
GHWTGDVLSTWEHLYYTISAVLLFNLYGVPLVGADVCGFVGSTSEELCVRWTQLGAFYPF
MRNHNDRRNLPQEPYVFSQKAQQAMRKALFLRYSFLPYLYTLFHKAHSAGETVARPLYLE
FPEDPNTWNVDRQFMWGSGLLITPVLEAGKTEVSGYFPLGTWYNPLTGFIIHSKGQWILL
SASLDTINVHVRAGHILPLQKPAFTTTESRKNGMILVVALTMEGVARGDLFWDDGEGLFT
FEKGDYTQILFLARNGMLVNEIVRLNSQVDGLLLKEVLIFGVLSPPHTVLANGTPISDFS
YRTDTKILNIPLSLLMGEQFVITWS
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgctactgattgagaagcctgagcacaggggactgtgtgtgatcctgtgggtttttatc
agcatcactttgctcagcgtctcagggacccacggagcacctcaagaggcagagaagaga
ggcagggagaaggacagaggtggagaagcagaggaacaacatgagaaacttgctgatcag
ccagatctgcttagaagctccagcattcaacccacccaatgtgacatccctccagacagc
cgctttgattgtgccccagataaactgctctctcaagaagaatgtgaagctcgaggctgc
tgctacatccctgctcagcccaagggcaatgctatttggcaaccgtggtgtttcttccct
cccagctaccccagttacaagatggtgaacctgactaccaccaaaactggttatactgcc
cagttgactcgggacagacccactttcatgccagaagatataatgaacttggagttggat
gtgctctttgagacggaaagtaggcttcacttcacacttaaggatccagctaataaacgt
tatgaggtacctttagaaactccccaatcaagcaacaaggcatcctccacatggtactca
gtgcagttctcagatgatccctttggcctcattattcttcgtacgtccaatggacgtgta
ttgctcaatacctcagtggcccccctattttatgcagaccagttcctgcagatctcaact
tccttgccttcccatttcatctctggactgggtgagcatttgacttcactcacccttagt
gtcaactggaccaaggttaccatgtggaatcgagacatgtcaccgatgccttcagccaat
ttgtatggttcacatcctttctatctagtgctagaagaggatggcttggcccatggagtc
tttttgctaaacagcaatgccatggatgtgatactgcagcccagtccagccctgacatgg
agaacaactggggggatcctggacttctatgtcttcctgggcccagacccaaagagtgtg
gtgcgccagtatatggatgtcattgggtatccatttatgcccccatactgggccctggga
ttccatctctgccgctggggatatgcttcgactgccgttacccgggaggtggtgaagaac
atgacagctgcacagttccccttggatgtgcagtggaatgatctggattatgcagatgct
gggagagattttaccttcaacaaagatgcttttggggatatgccagaaatggtgaatgaa
ttccatcgtgagggacggaggtatgtcatgatcgtggatgccggcatcagcagttctagc
cccactggcacttacaaacctttcgatgaaggcttgaaacgtggggtcttcatcttaaat
gcaactggacagcctctgattgggaaggtttggcctggacccacagccttccctgacttc
acaaatccagagacacatcagtggtggcatgatatggttaaggatttccatgatcaagtt
ccttttgatggcatgtggattgatatgaatgagccatcaaattttgtggaaggttctgtg
gaaggctgtcccaacaacaagcttgaggccccaccttatgtgccaggtgtattaggtgga
tccttgaagtcgcgaactctttgtgcctccagtaagcaatatctgtcttctcactacaac
ctgcacagtctgtatggactgacagaagccatagcatcccatgatgcattggtgaaagtg
cgaggaaagcgtccgttcgtgatctcacgttccaccttcgccagccacggtcgatatgct
ggccattggacaggggatgttttgagtacctgggaacacttatactacaccatctcagcg
gtgctgctttttaacctttacggtgtgccgttagttggtgcagatgtgtgtggttttgtg
gggagcacctcagaggagctttgtgtgcgctggacccagcttggtgccttctaccctttt
atgcgaaatcacaatgaccgcagaaacttgcctcaggaaccatacgtcttcagccaaaag
gcccagcaggctatgagaaaagccctcttcctgcgctactcattcctgccttatctctac
actctcttccacaaagctcactctgcaggggagacggtggcccggcccctctatttggag
ttcccagaagatccaaatacatggaatgttgatcggcagttcatgtggggatcaggactt
ctcattacacctgtgttagaggcaggaaagactgaagtcagtggctatttccctttgggc
acatggtacaatcctctgactggatttatcatacacagcaaggggcagtggattctctta
tcggcttctcttgacactatcaatgtccatgtacgtgcaggtcacatcctacctttgcag
aaaccagcattcacaaccacagagtctcgcaaaaatgggatgatcttagtggtggctttg
acgatggaaggggtagcccgaggcgatctgttctgggatgatggtgaaggactatttacc
tttgaaaagggcgattacacacaaatcctcttcctggcaagaaatggtatgttggtgaat
gagattgtgcgactcaacagccaggtggatggactgctattgaaagaggtgttgattttt
ggtgtactcagccctcctcatactgtcctggccaatggtacccccatctcagatttctcc
taccgcacagacaccaagatccttaacatcccactctccctgctgatgggagagcaattt
gtcatcacatggtcttaa

DBGET integrated database retrieval system