KEGG   Anolis carolinensis (green anole): 100561948
Entry
100561948         CDS       T01608                                 

Gene name
atr
Definition
(RefSeq) ATR serine/threonine kinase
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs03460  Fanconi anemia pathway
acs04110  Cell cycle
acs04115  p53 signaling pathway
acs04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100561948 (atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100561948 (atr)
   04115 p53 signaling pathway
    100561948 (atr)
   04218 Cellular senescence
    100561948 (atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100561948 (atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acs03400]
    100561948 (atr)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100561948 (atr)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100561948 (atr)
DNA repair and recombination proteins [BR:acs03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100561948 (atr)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I
Other DBs
NCBI-GeneID: 100561948
NCBI-ProteinID: XP_008104413
Ensembl: ENSACAG00000004915
UniProt: G1KDD8
LinkDB
Position
3
AA seq 2649 aa
MGDQGLEMASVIPALRELGSATPEEYNTVVQKPRQILCQFIDRILVDVDVVALELVKKTD
SQPSSVMLLDFILHIMKSSPLVFVNVTGTHQQNEAEASCVEFSSWIIARLLRVAATPNCH
VLHENISNVIYSLLCLLKVKNSAIFNLLTRELLDILQDLILLHERSAERCPQGDLLSWPV
TVSRFTCNPNINLGCLSSVHFQLMGMSNVECLEITLIRILIDLVPYIFFKRQDVILWGIG
CSLWDYGTPKVKVSSMTFLTELVQLGGPPEELASSFFSILFGILQSIPKMSAEKLELYEE
PLSVLVRTLFPFEMHSCENIEPIYLSILLEKLHALFEAGVLRTLQSEVMKRVLCHMFQYF
MCVPAGFESAVPVRKTSIDSICRLIVSIIGTQVEQEYLKSPLYASLKTEVTDIIQELQRS
HNPEDSDTDGGSSSSDEVPEKRLRLSLKQPKKSSMPAHPSPVNMIAKSVVWNSINKKGES
LVLLLEQDILPQEVLQTVEGIALIFQLAALCTVHSVPEFSSTGNKQNNTVCPSESGQRVR
LIWISSELLLRGVKVCWKLLDPAAGIIELEPVIQRVVKITDALLYMQANIQFNDEMIENI
IGLLSLPWVYSLSDDPSFKLPALNLDLLALSQHCKNHISPETQSDCLFLLSLIPKRHLKW
RNHIYQHSLQSPHEVIRANCVRGFPILLHQSGVKSCTTLLAPLLNNIRDESLLVQKAYAG
IIGNLACCLSGNLNLRPDVIQPDMQPKSNGVLCNSLTVTSSGEEMRAVKADVFKPFLYLL
EDNIASTVKLVLIENIPLFCKHLDFKKDGLNVKAVVEAFLKLMEDPDRDVRVAFSARIKY
ILDSSGSEEGFIKELLVSRMKEAYTNAKISRNNDLKDTLILTTGDIGRAAKGDLVPFALL
HLLHCLLSKSASVAGAAHTEIRGLAASKSLKLQAFFSQYKKPICQFLVESLHSSQLAMIS
NTPYQSSEMQKQEIAHQREAALDMLSEIANVFDFPDLNRFLNRILQVLLPDLAAKASPAA
SVLIRTIAKQLNVNRREILINNFKYIFSHLVCFCSKDELERALHYLKNETEIELGSLLRQ
DYQGLHNELLLRLGEHYQQVFNGLSILASFASNDDPYQGPKDITSSERMADYLQPRLLGI
LAFFNMQLLSSSVGIEDKKMALNSLMALMTLMGPKHISAVRVKMMTTLRTGLRYKDDFPE
LCCKSWDCFVRCLDQIHLGSLLSHVIVALLPLIHLQPKETAAVFHFLIVENRDVVQDFLH
EIYFLPNHPELKEIQIVLQEYRKETSKSTDLQTALQLSMKAIQHENVDVRIHALTSLKET
LYKNQEKLIKYATDSETVEPVISQLVTVLLIGCQDVNSHARLLCGECLGELGAIDPGRLD
FSTSDSQGKGLTFVTGVEDPHFAHGLFMELTRAFLAYADNVRAQDSASYAIQELLCIYGC
RETTTDCSGSKLWKMFPDHIQEILEPHLNTRYKSYQKAVNWSKVKKPIYLSKLGKRFAEW
SATWAGYLATKVRHDLASKVFNCCSIMMKNDFKVTIYLLPHILVYVLLGCSQEDQQEVYA
EIMAVLKNDDTISRPCEDSASDLSHLSTQTIFSMLDHLTQWARYKFQKLSADKASIKPSK
DLTEQQAPNEEYREYQSVVRFLDLIPQDTLAAASFRSKAYTRAVMHFESFIIEKKQNIQE
HLGFLQKLYAAMHEADGVEGVSAIRKAEPSLKEQILEHESIGLLRDATACYDRAIQLEPE
QIIHYHGVVKSMLGLGQFSTVITQVNGVLAKRPEWTPELNTYRVEAAWKLTQWDSLENYL
AADDKSNTWSVRLGQLLLSAKKKETPTFYEMLKVVRGEQIVPLSAASFERGSYQRGYEYI
TRLHMLCELEHRIGPLLQQPGNESGKDSLNWHARIEMTQNSYRVKEPILALRRALLSLNK
SEDYSERMGECWLQSARVARKAGHHQTAYNALLNAGESKLSELYVERAKWLWSKGEAHQG
LIILQKGVDLCFPDGQVPSGSKSKLIHGQALLLVGRFMEETANFESNAVMKKYKDVTVCL
PEWENGHFYLAKYYDKLMPTVTENKMEKQGDLIKYIVIHFGRSLHFGNQFIYQSMPRMLS
LWLDFGAKAYECEKAGRQDRTQMRNDLAKINKAIAEHTQLLAPYQFLTAFSQLISRICHS
HDEVFVVLMAIIAKVFVAYPQQAMWMMTAVSKSSYPMRVNRCKEIFNKAIHMKASLGKFI
GDAARLTDKLLELCNKPVDGSTNTLSMGVHFKSLKRLIEDQTFSEILIPLQSVMIPTLPS
VPGTHSNHDPFPGCWAYIAGFGDTVEILPSLQKPKKITLKGSDGKSYIMMCKPKDDLRKD
CRLMEFNSLINKCLRKDAESRRRELHIRTYAVIPLNEECGIIEWVNNTSGLRNILIKLYK
EKGIYMTGKELRQCMLPKITPLPEKLKVYKETLLPRHPPIFHEWFLRKFPDPTSWYSSRS
AYCRSTAVMSMVGYILGLGDRHGENILFDSLTGDCVHVDFNCLFNKGETFDFPEVVPFRL
THNMVNGMGPMGTEGLFRRACEVTLRLMRDQREPLMSVLKTFLHDPLVEWSKPARGSSKT
LVNETGEIVNEKAKTHVQDIDQRLQGVIKNRNRVKGLPLSIEGHVHHLIQDATDETLLCQ
MYLGWAPYM
NT seq 7950 nt   +upstreamnt  +downstreamnt
atgggcgaccaggggctggagatggcttcggtgatcccagccctccgggaactgggcagt
gcgaccccagaggaatacaatactgttgtgcagaaaccaagacaaattctctgccagttc
attgatcgaattctagtggatgtagatgttgttgctctagaacttgttaagaaaactgac
tcacagccaagttctgtaatgttgctcgattttatactacatattatgaaatcatcccca
cttgtatttgtaaatgtgactggaactcatcagcaaaatgaagcagaagccagctgcgtt
gaattcagtagttggatcattgcaagacttctgagagttgctgccactcctaactgccac
gtgttacatgagaacatcagtaatgtcatttattctttattatgccttctcaaagtgaaa
aacagtgccatatttaacttgttgacaagagaattactggatatccttcaggatctgatt
ttactccatgaaagaagtgcagaaaggtgcccccaaggagatttacttagctggcctgtg
actgtgagccgtttcacgtgcaatcccaatataaatctgggctgtttaagttctgtccat
tttcagttaatgggcatgagcaatgtggagtgcttggagataactttgataagaattctc
attgatctagttccttatattttttttaagcgacaggacgttatcctttggggaataggg
tgctcgctatgggactatggcactcctaaagttaaagtttcgagcatgacctttttaaca
gaattggtacagctaggaggacctccagaagaactggccagcagctttttctccattctt
tttggaatcttgcagtccattcctaaaatgagtgctgaaaagttagaactctatgaggaa
ccattgtcggtactcgtgaggactttgtttccatttgaaatgcattcctgtgagaatatt
gaacctatttatctcagcatattattggagaaactgcatgcgttgtttgaagccggcgtc
ctcagaactcttcagtctgaggtgatgaaaagagtcttatgtcacatgttccaatatttc
atgtgtgtgccagctggatttgaatctgctgttccggttagaaagaccagcattgacagc
atttgcagactgattgtctcaatcattggaacacaagtggagcaagagtatcttaagagt
ccactttatgcttccttgaagaccgaagtcacggatatcattcaggagctgcagcgtagt
cataatccagaggactctgatactgatgggggaagcagcagtagtgatgaagttcctgaa
aaaaggctacgtctgtccttgaagcaacccaaaaagtcctctatgccagcacaccccagt
cctgtgaacatgatagcgaagagtgtggtgtggaattcaataaacaagaaaggagaatct
ctggtgttacttctggaacaagacattctgccacaggaagttctgcaaactgttgaagga
attgctttgatatttcagctggctgctctgtgcacagtccactccgtgccagaattcagc
agcacaggaaacaaacaaaataatactgtttgtccttcggaatcaggacagcgtgtccgg
ttaatctggatttcttcagaattgcttttgagaggagtgaaagtttgttggaagttgtta
gatcctgctgcaggcataattgaacttgaaccagtaattcaaagagtcgtgaaaataaca
gatgctttgctttatatgcaagcaaacatccagtttaatgatgagatgattgaaaacata
attggattgctctctctgccatgggtttatagcctttctgatgacccttcgttcaagctg
cctgctcttaatttggatcttttggctttaagccaacattgtaaaaaccatatttctcct
gagactcagtcggattgtctatttcttctttctttaattccaaaaagacatctcaagtgg
agaaatcatatttatcagcattccctgcaaagtccccatgaagttatcagagcaaactgt
gttagaggatttcctatcctgctccaccagtcaggggtaaaatcctgcaccactctgctg
gcacctctcctaaacaacataagggatgaatctctgctagtccagaaagcttatgctggt
atcattggaaacttggcttgctgtctttctggcaacttgaatttaaggcctgacgtgatt
caacctgacatgcagcccaaaagtaatggcgtcctctgtaacagtcttacagtgacttct
tctggtgaggaaatgcgtgcagtgaaggctgatgtgtttaagccatttttatatctactt
gaagacaacatagcaagtacagtgaaacttgttttaatagagaacattcccctgttttgc
aaacatctggacttcaaaaaagatgggctaaatgtgaaagctgttgttgaggctttctta
aagctaatggaagatccagacagagatgtaagagtggcttttagtgcccgcatcaagtac
atattggattcttccggctctgaggaaggattcattaaagagctacttgtttccagaatg
aaagaggcctatacaaatgctaaaatatcaagaaataatgatctgaaagatacgctgatt
ctcacaacgggggatattgggagggcagcaaaaggggatttggtaccctttgcactcttg
cacttgctgcattgcttactgtccaagtcggcttctgtagctggagcggctcatacagaa
atcagaggtctggctgcgtccaagtctttgaagctgcaggcctttttcagtcaatacaag
aaacccatctgtcagtttttagtggaatccctacactccagtcagttggcaatgatttct
aacacaccataccaaagcagtgaaatgcagaaacaagagattgctcatcaaagggaggca
gctctggacatgttatctgaaattgccaatgtttttgattttccagacctcaatcgtttt
ctcaataggattctccaagttcttttgcctgaccttgctgccaaggctagtcctgcagct
tctgtgctgatccgaacaatagcaaaacagctaaatgtaaatcgcagagaaattctcatc
aacaacttcaaatatatcttctctcatttagtctgcttctgtagcaaagatgagctggag
cgagcacttcactatctcaagaatgaaacagagatagaattgggaagtttgctgagacaa
gactatcaaggattgcataatgaattattgttgcgtttgggagaacactatcaacaggtt
ttcaatggcttatcaattctggcttcttttgcttctaatgatgacccatatcaaggaccc
aaagacatcacatcttctgagcgaatggctgattatctacaaccaagattgctgggcatt
ttggccttcttcaatatgcagttattgagctctagtgttgggattgaagataaaaaaatg
gccttaaatagtttgatggctttaatgactcttatgggtccaaaacacataagtgctgta
agagtgaagatgatgacaacactcagaactggactgagatacaaagatgatttcccagag
ctgtgctgcaaatcttgggactgctttgtccgatgcttggaccagattcatcttggctcc
cttctcagtcatgtgatagtggctctgttgcccctcatacatcttcagccaaaagaaaca
gcagcagttttccattttcttatagttgaaaacagagatgtggtgcaagatttccttcat
gaaatatattttctaccaaatcatcctgagctgaaagaaattcaaattgttcttcaggaa
tatagaaaggagacatccaaaagcaccgacttgcagacagcgctgcagctttccatgaaa
gctattcaacatgagaatgtagatgttcggattcatgctctcaccagcctcaaggaaact
ttatataaaaatcaagagaaactgataaagtatgcaacagatagtgaaacagttgagcca
gttatttctcagctggtgaccgtacttctgattggctgccaggatgtgaattctcatgcg
cggctgctgtgtggggaatgtttaggtgaactgggagccatagatccaggcaggttggat
ttctcaacaagtgacagtcaaggaaaaggccttacatttgtgactggtgtagaagatcca
cattttgcccacggattattcatggagctgacaagagcattccttgcatatgctgataat
gttcgggctcaagattctgcttcatacgctattcaggagttgctatgcatctatggttgt
agggagacaactactgactgctcaggctccaaactttggaaaatgtttcctgatcatatt
caagaaatattggaacctcatttaaatacacgatacaagagttatcaaaaggctgtaaac
tggtcaaaggttaaaaagcctatttacttgagtaaattaggcaaaagatttgcagaatgg
tcagcaacctgggctggttaccttgcaactaaggtgcgacatgatcttgccagtaaggtt
tttaactgttgcagtattatgatgaagaatgacttcaaggtgaccatctatctccttccc
catattctcgtttatgtccttttgggatgcagtcaggaggatcagcaagaggtttatgca
gaaatcatggctgtacttaaaaacgacgataccatttcaagaccatgtgaggatagcgca
tcagatctcagccatttaagcacacagacaattttctctatgcttgatcatctgacacag
tgggctagatataaattccaaaagctgagtgctgataaggcttctatcaagccaagtaag
gacctaacagaacaacaagcaccaaatgaagaatatagagagtaccaaagtgtagtccgc
tttcttgacctcatacctcaggacacattggctgccgcttcctttcgctcgaaagcatac
acaagagcagtgatgcactttgaatcattcatcattgaaaagaaacaaaatattcaagaa
catctgggatttctacagaaactgtatgcagcgatgcatgaggcagatggagtggaagga
gtgagtgcaatacggaaagcagagccatcgctcaaagaacagatccttgaacatgaaagc
attggattgttgagagatgccacagcttgctatgacagggcgattcagctggagcctgag
cagataattcactatcatggtgtggtgaaatctatgctgggtcttggtcagttctctact
gtaatcactcaagtgaatggagtacttgctaagcgacctgagtggactcctgaattaaat
acctacagagtggaggcggcctggaaactgacccagtgggattcactagaaaactaccta
gctgcagatgacaagtctaatacttggagcgttcgacttggacagttgttactctctgct
aaaaagaaagaaactcccactttctatgaaatgttgaaagttgtccgaggagagcagata
gttccactttcagcagcaagttttgaaaggggttcatatcagcgaggatatgaatacatt
acaaggttacacatgctatgtgagttggagcatcgtattggaccactgcttcaacaacct
ggtaatgagagcggaaaagattccttgaactggcacgcgcgaatagaaatgacccaaaat
tcatacagagttaaagagcccatcctggcacttagaagggctttactcagcctcaataaa
agtgaggattatagtgagaggatgggagagtgctggctccaaagcgctcgagttgcccgt
aaagctggccatcaccaaacggcatacaatgctctcctcaatgctggggaatctaagctg
tctgaactctatgtggaaagagcaaagtggctgtggtccaagggtgaggctcatcaaggt
cttatcatccttcaaaagggggttgacctttgttttccagatggccaggtaccatctggc
agtaaaagtaaactaattcatgggcaagctctgttgctggtgggcagatttatggaagaa
actgccaactttgaaagtaatgcagtcatgaaaaaatacaaggatgtcactgtgtgcttg
ccagaatgggaaaatggacacttctacctcgctaaatactatgataaactgatgcctacg
gtgacagaaaataagatggaaaaacagggagatttgattaaatatatcgttattcacttt
ggaagatctttacattttggaaaccagttcatctatcagtcaatgccaaggatgttatca
ctgtggcttgactttggagcaaaagcatatgaatgtgagaaagctggtcgtcaagatcgt
actcaaatgagaaatgacttggctaagatcaacaaggcgattgcagagcatacgcagctc
ttggcaccatatcagtttttaacagctttctctcaactgatctcccgaatttgccactcg
cacgatgaagtctttgtggtccttatggcaataattgctaaggttttcgtagcataccct
caacaagcaatgtggatgatgactgcagtttctaagtcatcttacccaatgcgtgtaaac
agatgcaaggaaatcttcaacaaagctattcatatgaaggcatctttggggaaattcatt
ggagatgcagctcgcttaacagataaactccttgagctatgtaacaaaccggttgatggg
agcaccaacactttaagcatgggagttcatttcaaaagtctcaaaaggctgatagaagac
cagacattcagtgagatccttattcctttacaatctgtaatgataccaactctcccttcg
gttcctggaacacattccaatcatgatccgtttcctggatgctgggcttatattgctggc
tttggtgatacagttgaaattcttccatcgcttcagaagccaaagaagattactttaaaa
ggctcagatgggaaatcctatatcatgatgtgtaagcccaaagatgatctgagaaaggac
tgtcgactgatggaattcaattctcttattaataagtgtctaagaaaggatgcagagtca
cggagacgagaactccacatccggacgtatgctgttattcctttgaatgaagaatgtgga
ataattgaatgggtgaacaacacttctggcttaagaaacatcctgatcaagttatacaag
gagaaaggtatctatatgactggaaaggaactgcgccagtgcatgcttccaaagataaca
cctttgcctgaaaagctgaaagtttacaaagagactctacttccccggcaccctccaatc
tttcacgaatggtttctgagaaaattccctgatcccacttcgtggtacagcagcagatca
gcgtattgccgttccactgcagtgatgtcaatggttggatacatactgggccttggagac
cgtcatggggaaaatattctgtttgattctttaaccggtgactgtgtgcatgtggatttc
aactgtcttttcaataagggagaaacttttgattttccagaggttgtcccatttcgcctg
acgcataacatggtcaatgggatgggtccaatgggaactgaaggtcttttccgaagggct
tgtgaagttacattaagacttatgcgtgaccagagagaaccactaatgagtgttttgaaa
acttttctccatgatcctttggtggagtggagtaaaccagcaagaggcagttcaaaaacc
ttagtgaatgaaactggagaaattgtcaatgaaaaggccaagacccacgtccaggatatt
gatcagcgactacaaggtgtaattaaaaacaggaatagagtaaagggcctgcctttgtct
attgaaggacatgttcaccatcttatccaagatgcaactgatgagaccttgctgtgccag
atgtaccttggatgggctccatacatgtga

DBGET integrated database retrieval system