KEGG   Anolis carolinensis (green anole): 100562632
Entry
100562632         CDS       T01608                                 

Gene name
cdk1
Definition
(RefSeq) cyclin dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04110  Cell cycle
acs04114  Oocyte meiosis
acs04115  p53 signaling pathway
acs04218  Cellular senescence
acs04540  Gap junction
acs04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100562632 (cdk1)
   04114 Oocyte meiosis
    100562632 (cdk1)
   04115 p53 signaling pathway
    100562632 (cdk1)
   04218 Cellular senescence
    100562632 (cdk1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100562632 (cdk1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100562632 (cdk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100562632 (cdk1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acs03032]
    100562632 (cdk1)
   03036 Chromosome and associated proteins [BR:acs03036]
    100562632 (cdk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100562632 (cdk1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100562632 (cdk1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100562632 (cdk1)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100562632 (cdk1)
DNA replication proteins [BR:acs03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100562632 (cdk1)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100562632 (cdk1)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100562632 (cdk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Seadorna_VP7 Kinase-like Haspin_kinase
Other DBs
NCBI-GeneID: 100562632
NCBI-ProteinID: XP_003223483
Ensembl: ENSACAG00000011086
UniProt: H9GH90
LinkDB
Position
Un
AA seq 313 aa
MKDGIQHHSIMDKYTKIEKIGEGTYGIVYKGKHKATGKVVAMKKIRLESDEEGVPSTAIR
EVSLLKELHHPNIVCLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPSGQFLDRMLVKSYLH
QILQGIEFCHSRRILHRDLKPQNLLIDDNGVIKLADFGLARAFGIPVRVYTHEVVTLWYR
SPEVLLGAARYSTPIDIWSIGTIFAEMATKKPLFHGDSEIDQLFRIFRALGTPNNDVWPE
VESLQDYKNTFPKWKPSSLASHVKHLDDNGLDLLSKMLTYDPAKRISGRAALNHPYFDDL
ERSKLPANCIKKC
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaaggacgggatacaacatcacagcataatggataaatacacaaaaatcgaaaagatt
ggtgaaggtacttatggcattgtgtataaaggcaaacacaaagccacgggcaaagtggtc
gccatgaagaagattcgactggagagtgatgaagaaggagttcctagcactgcaatcaga
gaagtttccttattaaaagagctacatcaccccaatatagtttgtctccaggatgtgctt
atgcaagactcaaggctttatcttatctttgaatttctttctatggatctcaagaaatac
ctggattctattccatctgggcagtttttggatcgtatgcttgtgaagagttatttgcac
caaatcttacaaggcattgagttctgccattcaagaagaattctacatagagacctgaag
ccacagaatctcctaattgacgacaacggagtaattaaactagctgattttgggctggcc
cgggcttttggcatccctgtccgtgtttacacacatgaggtagtaacgctgtggtacaga
tccccagaagtgctgctaggtgccgcacgttactctactcccatagacatatggagcata
ggtaccatatttgcagaaatggcaacaaagaaaccgctcttccatggagactcggaaatc
gatcaactcttcagaatctttagggctttgggcacccccaataatgatgtgtggcctgaa
gtggaatccttgcaggattacaagaacaccttcccgaaatggaaaccgagcagcttggcc
tctcatgtgaaacacctggacgacaacggactagacttgctttctaaaatgttaacttac
gatcctgcaaaaaggatttctggccgtgctgctttaaatcatccctactttgacgacttg
gagagatccaaactgccagccaattgtatcaagaaatgctaa

DBGET integrated database retrieval system